DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT8 and fab1

DIOPT Version :9

Sequence 1:NP_610418.1 Gene:CCT8 / 35882 FlyBaseID:FBgn0284436 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster


Alignment Length:347 Identity:76/347 - (21%)
Similarity:139/347 - (40%) Gaps:83/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ESAEELLRLGITTAEISDGYEKALEKALE-----------ILPNLVSHKIEDYRNVEKVKEVLRT 166
            :||||              .||.||..||           :|.:...|:      .:.:.::||.
  Fly   429 QSAEE--------------KEKELENELENDRCYTTATSKLLASYCEHE------EQLLAQMLRA 473

  Fly   167 SIMSKQYGQEDFLNDLVSKACVSILPDEGTFNVDNIR----ICKILGSGLTKSEVVRGMVFKRFV 227
            ..:.:::  :..|..|.|.|.....|:..:.::.:||    ..|:.|.....|::|.|:.|.:.|
  Fly   474 HNLDQEW--DKVLQMLCSTAANHFKPEHCSNDLMDIRNYVNFKKVPGGRRKDSKIVHGVAFSKNV 536

  Fly   228 --EGDVTYAEKAKIVIFSCPVDIIQTETK----GTVLIKSADELLSFSSGEESLLESQIKAIADA 286
              :...|:....:|::..||:...:.|.|    .|||::           |:..|.:....|...
  Fly   537 AHKDMATHVPFPRILLLQCPIVYERIEGKFVTIETVLLQ-----------EKEYLRNVCARIMSF 590

  Fly   287 GVKVVVAGGKVGDMALHFLNKYGLMAVRLNSKFD-LRRLSRSVNATVL----PRITTPSQEELGY 346
            ...||:....|..:|...|..|.:..| |:.|.. :.||||::...::    ..||.|   :|||
  Fly   591 KPNVVLVHKNVAGIAQDLLRSYEVTLV-LDVKLSVMERLSRTLQCDIVSSIESNITMP---KLGY 651

  Fly   347 CDKVCIEELGDTTIVAFRNEGKDSRIATVVIRGATDNFMDDIER---ALDDAINNFKCLTRDGRY 408
            |:...|......|::.| .:..:.|..|.::||.::..:..::|   ||..|..|::        
  Fly   652 CNDFYIRNYNGKTLMFF-EKLTNPRGYTCLLRGGSNAELTRVKRVASALLFARYNWR-------- 707

  Fly   409 LPGAGATEIELATQLSAYADTL 430
                    :|::..|:.:|..|
  Fly   708 --------LEMSFLLNEFAQPL 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT8NP_610418.1 TCP1_theta 20..529 CDD:239457 76/347 (22%)
Cpn60_TCP1 40..529 CDD:278544 76/347 (22%)
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450 62/286 (22%)
PIPKc 1413..1797 CDD:295374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.