DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT8 and CCT4

DIOPT Version :9

Sequence 1:NP_610418.1 Gene:CCT8 / 35882 FlyBaseID:FBgn0284436 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_006421.2 Gene:CCT4 / 10575 HGNCID:1617 Length:539 Species:Homo sapiens


Alignment Length:517 Identity:155/517 - (29%)
Similarity:266/517 - (51%) Gaps:35/517 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FRNISACKEFAQTMRSAYGPNGMNKMIINHIEKQFVTSDAGTIMRELDVEHPAAKLIVMASQMQD 94
            |.||||.|..|..:|::.||.||:|||.:......:|:|..||::::.|.||||:::|..|:.||
Human    35 FSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQD 99

  Fly    95 AEVGDGTNFVVVLAGALLESAEELLRLGITTAEISDGYEKALEKALEILPNLVSHKIEDYRNVEK 159
            .|.||||..||::||:||:|..:||:.||....||:.::|||||.:|||.:: |..:| ..:.|.
Human   100 IEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDM-SRPVE-LSDRET 162

  Fly   160 VKEVLRTSIMSKQYGQ-EDFLNDLVSKACVSILPDEGTFNVD--NIRICKILGSGLTKSEVVRGM 221
            :.....||:.||...| ...|:.:...|.:.::......:||  :|:|.|.||..:...|:|.|:
Human   163 LLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGL 227

  Fly   222 VFKRFVEGD-VTYAEKAKIVIFSCPVDIIQTETKGTVLIKSADELLSFSSGEESLLESQIKAIAD 285
            |..:.|... :|..|||||.:....:...:|:....:::....::......|.:.:.:.:|.|..
Human   228 VLTQKVSNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKK 292

  Fly   286 AGVKVV-----VAGGKVGDMALHFLNKYGLMAVRLNSKFDLRRLSRSVNATVLPRITTPSQEELG 345
            .|..|:     :....:.|:|||||||..:|.::...:.|:..:.:::....:..|...:.:.||
Human   293 TGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLG 357

  Fly   346 YCDKVCIEEL---GDTTIVAFRNEGKDSRIATVVIRGATDNFMDDIERALDDAINNFKCLTRDGR 407
            ..:  ..||:   |...::.........:..|:|:||:....:::.||::.||:...:||.:...
Human   358 SAE--LAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRA 420

  Fly   408 YLPGAGATEIELATQLSAYADTLPGLDQYAVRKFANALEVFPKALAENSGINGTEIVNQLYLAHN 472
            .:.|.||.|||||.:|:.|:.||.|::.|.||.||:|:||.|..||||:|:|....|.:|...| 
Human   421 LIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRH- 484

  Fly   473 NEAGKTIGFDIEAEKASTIDTTKAKLFDLYQS--------KFWGLKYAVGAAATILKVDQII 526
                      .:.||.:.|:..|..:.::.:.        ....|..|.....:|||:|.::
Human   485 ----------AQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVV 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT8NP_610418.1 TCP1_theta 20..529 CDD:239457 155/517 (30%)
Cpn60_TCP1 40..529 CDD:278544 149/507 (29%)
CCT4NP_006421.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
TCP1_delta 25..538 CDD:239454 155/517 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D207515at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.