DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and KIF3B

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_004789.1 Gene:KIF3B / 9371 HGNCID:6320 Length:747 Species:Homo sapiens


Alignment Length:40 Identity:12/40 - (30%)
Similarity:22/40 - (55%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QQQRVVVEQLRREAAIDRQTIS--ESCAKMMKYITEHEQE 46
            |:::.:.||.|||..|.:|..|  |...::.:..:..:||
Human   494 QKRQEIAEQKRREREIQQQMESRDEETLELKETYSSLQQE 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 12/40 (30%)
KIF3BNP_004789.1 KISc_KIF3 8..340 CDD:276822
Smc <355..>581 CDD:440809 12/40 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..412
Globular 580..747
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 699..747
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.