DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Kif3a

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:XP_006246409.1 Gene:Kif3a / 84392 RGDID:621536 Length:726 Species:Rattus norvegicus


Alignment Length:46 Identity:10/46 - (21%)
Similarity:25/46 - (54%) Gaps:5/46 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQE 46
            :|:::.:.:|     |:|..|:.::.:...:...::.|.:.|.|||
  Rat   511 VDLLAKAEEQ-----EKLLEESNMELEERRKRAEQLRKELEEKEQE 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 9/39 (23%)
Kif3aXP_006246409.1 KISc_KIF3 13..345 CDD:276822
Smc <451..>615 CDD:440809 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.