DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Gng5

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_077353.1 Gene:Gng5 / 79218 RGDID:620807 Length:68 Species:Rattus norvegicus


Alignment Length:66 Identity:26/66 - (39%)
Similarity:41/66 - (62%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
            |||:...:.||:|||.||.::|..:|::.|.:.::..::.|.|.|||| .|...||||.:..|:.
  Rat     4 SSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTG-VSSSTNPFRPQKVCSF 67

  Fly    70 L 70
            |
  Rat    68 L 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 21/56 (38%)
Gng5NP_077353.1 GGL 7..63 CDD:238024 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11035
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1581168at2759
OrthoFinder 1 1.000 - - FOG0000162
OrthoInspector 1 1.000 - - mtm12318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13809
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.