powered by:
Protein Alignment Ggamma1 and gng4
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001165066.1 |
Gene: | gng4 / 779661 |
XenbaseID: | XB-GENE-987532 |
Length: | 75 |
Species: | Xenopus tropicalis |
Alignment Length: | 74 |
Identity: | 31/74 - (41%) |
Similarity: | 44/74 - (59%) |
Gaps: | 6/74 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 DVMS----SSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFR 62
|.|| :|:.|.|..||||:.||.:||..:|::.|.:|.|...|.:||.|:....:.: ||||
Frog 3 DSMSNNSTTSISQARKAVEQLKMEACMDRIKVSKAAADLMAYCDAHVREDPLILPVPASE-NPFR 66
Fly 63 EKS-SCTVL 70
||. .||:|
Frog 67 EKKFFCTIL 75
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
23/56 (41%) |
gng4 | NP_001165066.1 |
GGL |
13..75 |
CDD:128520 |
26/62 (42%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I10936 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
57 |
1.000 |
Inparanoid score |
I5241 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1581168at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000162 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm9382 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 5.060 |
|
Return to query results.
Submit another query.