powered by:
Protein Alignment Ggamma1 and Gng11
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079607.1 |
Gene: | Gng11 / 66066 |
MGIID: | 1913316 |
Length: | 73 |
Species: | Mus musculus |
Alignment Length: | 61 |
Identity: | 24/61 - (39%) |
Similarity: | 37/61 - (60%) |
Gaps: | 1/61 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 QQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
::.::.|||||:|..:.||.:|:...::..||.|...||.|:.|....| |||:||.||.:
Mouse 13 EKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDK-NPFKEKGSCVI 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167838158 |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I11276 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
56 |
1.000 |
Inparanoid score |
I5429 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13809 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.950 |
|
Return to query results.
Submit another query.