DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Gng11

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_079607.1 Gene:Gng11 / 66066 MGIID:1913316 Length:73 Species:Mus musculus


Alignment Length:61 Identity:24/61 - (39%)
Similarity:37/61 - (60%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
            ::.::.|||||:|..:.||.:|:...::..||.|...||.|:.|....| |||:||.||.:
Mouse    13 EKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDK-NPFKEKGSCVI 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 21/55 (38%)
Gng11NP_079607.1 GGL 12..73 CDD:128520 24/61 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..73 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838158
Domainoid 1 1.000 53 1.000 Domainoid score I11276
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5429
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.950

Return to query results.
Submit another query.