DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Gng11

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_079607.1 Gene:Gng11 / 66066 MGIID:1913316 Length:73 Species:Mus musculus


Alignment Length:61 Identity:24/61 - (39%)
Similarity:37/61 - (60%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
            ::.::.|||||:|..:.||.:|:...::..||.|...||.|:.|....| |||:||.||.:
Mouse    13 EKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDK-NPFKEKGSCVI 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 21/55 (38%)
Gng11NP_079607.1 GGL 12..73 CDD:128520 24/61 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..73 11/23 (48%)

Return to query results.
Submit another query.