DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and kif26aa

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:XP_068071748.1 Gene:kif26aa / 567643 ZFINID:ZDB-GENE-041001-148 Length:1929 Species:Danio rerio


Alignment Length:59 Identity:14/59 - (23%)
Similarity:25/59 - (42%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VMSSSLQQQRVVVEQLRREAAIDRQTISE-SCAKMMKYITEHEQEDYLLTGFTSQKVNP 60
            |.|||.:|.|..:...::........:|| :.....|::...:|.|......||.::.|
Zfish  1600 VTSSSTKQGRGTIMGTKQALRAANSRVSELAVGSSKKHLRGSDQADENSDARTSSEMPP 1658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 10/54 (19%)
kif26aaXP_068071748.1 Motor_domain 393..737 CDD:473979
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.