powered by:
Protein Alignment Ggamma1 and kif26aa
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009302328.1 |
Gene: | kif26aa / 567643 |
ZFINID: | ZDB-GENE-041001-148 |
Length: | 1906 |
Species: | Danio rerio |
Alignment Length: | 59 |
Identity: | 14/59 - (23%) |
Similarity: | 25/59 - (42%) |
Gaps: | 1/59 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 VMSSSLQQQRVVVEQLRREAAIDRQTISE-SCAKMMKYITEHEQEDYLLTGFTSQKVNP 60
|.|||.:|.|..:...::........:|| :.....|::...:|.|......||.::.|
Zfish 1577 VTSSSTKQGRGTIMGTKQALRAANSRVSELAVGSSKKHLRGSDQADENSDARTSSEMPP 1635
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
10/54 (19%) |
kif26aa | XP_009302328.1 |
Motor_domain |
370..714 |
CDD:277568 |
|
KISc |
371..713 |
CDD:214526 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG4280 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.