powered by:
Protein Alignment Ggamma1 and kif17
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373250.1 |
Gene: | kif17 / 557863 |
ZFINID: | ZDB-GENE-080724-12 |
Length: | 823 |
Species: | Danio rerio |
Alignment Length: | 36 |
Identity: | 12/36 - (33%) |
Similarity: | 19/36 - (52%) |
Gaps: | 4/36 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 YITEHEQEDY--LLTGFTSQKV--NPFREKSSCTVL 70
::.|.||:.| :|....|:.: |.||.|.|..:|
Zfish 719 FVQEEEQDRYKEMLNRSDSEHIATNYFRPKRSSQLL 754
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
9/29 (31%) |
kif17 | NP_001373250.1 |
Motor_domain |
4..335 |
CDD:419868 |
|
Smc |
395..>650 |
CDD:224117 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG4280 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.