DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and KIF26B

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_060482.2 Gene:KIF26B / 55083 HGNCID:25484 Length:2108 Species:Homo sapiens


Alignment Length:33 Identity:10/33 - (30%)
Similarity:15/33 - (45%) Gaps:4/33 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VEQL-RREAAIDRQTISESCAKMMKYITEHEQE 46
            ||:| ||.....::.:   |......|.||.|:
Human  1997 VERLQRRRGGASKEAM---CFNAKLKILEHRQQ 2026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 10/33 (30%)
KIF26BNP_060482.2 KISc 450..798 CDD:276812
KISc 451..798 CDD:214526
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 805..825
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 876..917
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 937..1166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1406..1504
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1519..1653
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1685..1799
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1814..1974
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..124
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..287
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.