DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Kif9

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:XP_006244056.1 Gene:Kif9 / 501059 RGDID:1565187 Length:860 Species:Rattus norvegicus


Alignment Length:30 Identity:11/30 - (36%)
Similarity:15/30 - (50%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVVEQLRREAA-IDRQTISESCAKMMKYIT 41
            |:|..:..||| :|....|...|..||.:|
  Rat   382 VLVTNIYGEAAQLDETLSSLRFASRMKLVT 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 11/30 (37%)
Kif9XP_006244056.1 KISc_KIF9_like 76..408 CDD:276826 8/25 (32%)

Return to query results.
Submit another query.