powered by:
Protein Alignment Ggamma1 and gng2
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012823694.1 |
Gene: | gng2 / 448567 |
XenbaseID: | XB-GENE-961282 |
Length: | 145 |
Species: | Xenopus tropicalis |
Alignment Length: | 67 |
Identity: | 30/67 - (44%) |
Similarity: | 43/67 - (64%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 SSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKS-SCT 68
::|:.|.|.:||||:.||.|||..:|::.|.:|.|...|.:||.|||...:.: ||||||. .|.
Frog 80 TASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASE-NPFREKKFFCA 143
Fly 69 VL 70
:|
Frog 144 IL 145
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
26/56 (46%) |
gng2 | XP_012823694.1 |
GGL |
83..145 |
CDD:128520 |
28/62 (45%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I10936 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1581168at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000162 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm9382 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13809 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4581 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 6.140 |
|
Return to query results.
Submit another query.