DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Kif3C

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster


Alignment Length:46 Identity:12/46 - (26%)
Similarity:20/46 - (43%) Gaps:6/46 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNP 60
            |..|..|..:||:...:....:.:.:..|:|   |...|:|   ||
  Fly   528 VSDLNSEFQLDREDYLDEIRNLGRQVKFHQQ---LFLKFSS---NP 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 12/46 (26%)
Kif3CNP_651939.4 Motor_domain 3..339 CDD:473979
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.