DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and gng7

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_001002397.1 Gene:gng7 / 436670 ZFINID:ZDB-GENE-040718-93 Length:68 Species:Danio rerio


Alignment Length:66 Identity:26/66 - (39%)
Similarity:43/66 - (65%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
            ::::.|.|.:|||||.||.|:|..:|::.|.:|.|..:|.:.|.||.|..:.: |||::|..|.:
Zfish     4 TNNIAQARKLVEQLRIEAGIERIKVSKAAADLMSYCEQHARSDPLLVGVPTSE-NPFKDKKPCII 67

  Fly    70 L 70
            |
Zfish    68 L 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 23/56 (41%)
gng7NP_001002397.1 GGL 7..68 CDD:128520 25/61 (41%)

Return to query results.
Submit another query.