DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and gng12a

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_998477.2 Gene:gng12a / 406604 ZFINID:ZDB-GENE-040426-2555 Length:76 Species:Danio rerio


Alignment Length:66 Identity:27/66 - (40%)
Similarity:45/66 - (68%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
            |::|...|.:|:|||.||:|:|..:|::.|.:|:|..|:.:.|.||.|..:.: |||::|..||:
Zfish    12 SNNLAHARRMVQQLRVEASIERIKVSKASADLMRYCGENAKYDPLLMGIPASE-NPFKDKKPCTI 75

  Fly    70 L 70
            |
Zfish    76 L 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 22/56 (39%)
gng12aNP_998477.2 GGL 18..76 CDD:128520 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581987
Domainoid 1 1.000 54 0.240 Domainoid score I11186
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5442
OMA 1 1.010 - - QHG46185
OrthoDB 1 1.010 - - D1581168at2759
OrthoFinder 1 1.000 - - FOG0000162
OrthoInspector 1 1.000 - - mtm6366
orthoMCL 1 0.900 - - OOG6_105730
Panther 1 1.100 - - O PTHR13809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4581
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.