DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and CG14535

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_609156.1 Gene:CG14535 / 34073 FlyBaseID:FBgn0031955 Length:1131 Species:Drosophila melanogaster


Alignment Length:68 Identity:13/68 - (19%)
Similarity:30/68 - (44%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSLQQQRVVVEQLRREAAIDRQTISES----CAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSS 66
            ::|:|....:.::..|..||...:|.:    ...:|:.:...:|.:..:.|..||..   |..::
  Fly   569 AALEQLEAGMRKITEEQWIDGPRVSRAKVAEARHLMREVNHVKQCETWVDGPKSQSC---RSLTA 630

  Fly    67 CTV 69
            |.:
  Fly   631 CNL 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 12/60 (20%)
CG14535NP_609156.1 Motor_domain 44..394 CDD:473979
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.