DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Kif6

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_796026.2 Gene:Kif6 / 319991 MGIID:1098238 Length:802 Species:Mus musculus


Alignment Length:67 Identity:14/67 - (20%)
Similarity:35/67 - (52%) Gaps:13/67 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VMSSSLQQQRVVVEQLRREAAI---DRQTISESCAKMMK-------YITEHEQEDYLLTGFTSQK 57
            :|...||::   :|.|:.|.|:   :::|.:.:.|::::       |:.:.:.|..|..|...:|
Mouse   359 LMIVRLQKE---IEDLKAELAMATGEQRTEALTEAELLQLEKLIASYLEDQDPESRLEVGADMRK 420

  Fly    58 VN 59
            ::
Mouse   421 IH 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 13/62 (21%)
Kif6NP_796026.2 KISc_KIF9_like 5..343 CDD:276826
Kinesin 11..345 CDD:278646
Cob_adeno_trans <350..>408 CDD:294596 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.