DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Kif3b

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_001099999.1 Gene:Kif3b / 296284 RGDID:1306815 Length:747 Species:Rattus norvegicus


Alignment Length:40 Identity:13/40 - (32%)
Similarity:22/40 - (55%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QQQRVVVEQLRREAAIDRQTIS--ESCAKMMKYITEHEQE 46
            |:::.:.||.|||..|.:|..|  |...::.:..|..:||
  Rat   494 QKRQEIAEQKRREREIQQQMESRDEETLELKETYTSLQQE 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 13/40 (33%)
Kif3bNP_001099999.1 KISc_KIF3 8..340 CDD:276822
Smc <355..>581 CDD:440809 13/40 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.