powered by:
Protein Alignment Ggamma1 and GNGT2
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001185683.1 |
Gene: | GNGT2 / 2793 |
HGNCID: | 4412 |
Length: | 69 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 21/69 - (30%) |
Similarity: | 36/69 - (52%) |
Gaps: | 4/69 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 MSSSLQQQ---RVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKS 65
|:..|.:: ::.||||::|....|..||::..::.:|:......|..|.|....| |||:||.
Human 1 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDK-NPFKEKG 64
Fly 66 SCTV 69
.|.:
Human 65 GCLI 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
18/59 (31%) |
GNGT2 | NP_001185683.1 |
GGL |
8..69 |
CDD:128520 |
19/62 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165148066 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13809 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.900 |
|
Return to query results.
Submit another query.