DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ggamma1 and Kif15

DIOPT Version :9

Sequence 1:	NP_523662.1	Gene:	Ggamma1 / 35881	FlyBaseID:	FBgn0004921	Length:	70	Species:	Drosophila melanogaster
Sequence 2:	NP_034750.1	Gene:	Kif15 / 209737	MGIID:	1098258	Length:	1387	Species:	Mus musculus

Alignment Length:	95	Identity:	18/95 - (18%)
Similarity:	33/95 - (34%)	Gaps:	33/95 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 MSSSLQQQRVVVEQLRREAAIDRQTISESC-----------------AKMMKYITEHEQE----- 46
            :...|.|::..|||.:.|.::..:.:....                 |.:.|.:...|||
Mouse  1103 LQHKLNQEKEEVEQKKNEFSLKMRQLEHVMGSATEYPQSPKTPPHFQAHLAKLLETQEQEIEDGR 1167

  Fly    47 ------DYLLTGFTSQKVNPFREKSSCTVL 70
                  .:|:|     |:|..||..:..:|
Mouse  1168 ASKTSLQHLVT-----KLNEDREVKNAEIL 1192

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ggamma1	NP_523662.1	GGL	8..65	CDD:238024	17/84 (20%)
Kif15	NP_034750.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..23
		KISc_KLP2_like	25..373	CDD:276824
		KISc	26..370	CDD:214526
		Kinesin-relat_1	463..551	CDD:289481
		SMC_prok_B	520..1339	CDD:274008	18/95 (19%)
		HMMR_C	1267..>1387	CDD:292530
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4280
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900