powered by:
Protein Alignment Ggamma1 and gpc-1
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379097.1 |
Gene: | gpc-1 / 181424 |
WormBaseID: | WBGene00001681 |
Length: | 62 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 23/63 - (36%) |
Similarity: | 39/63 - (61%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTVL 70
::..:...|||..||.|.|:.:||...:::.:..:::..|.|::|.|.|. |||:||.||:||
Worm 1 MENIKASTEQLCAEANIQRKKVSEVSKELLDFCEKNKTNDMLVSGPTDQH-NPFQEKKSCSVL 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
18/56 (32%) |
gpc-1 | NP_001379097.1 |
GGL |
1..62 |
CDD:128520 |
21/61 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
44 |
1.000 |
Domainoid score |
I8340 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
45 |
1.000 |
Inparanoid score |
I4137 |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3174 |
OMA |
1 |
1.010 |
- |
- |
|
QHG46185 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1581168at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000162 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm14742 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105730 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4581 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
11 | 10.860 |
|
Return to query results.
Submit another query.