DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and gpc-1

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_001379097.1 Gene:gpc-1 / 181424 WormBaseID:WBGene00001681 Length:62 Species:Caenorhabditis elegans


Alignment Length:63 Identity:23/63 - (36%)
Similarity:39/63 - (61%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTVL 70
            ::..:...|||..||.|.|:.:||...:::.:..:::..|.|::|.|.|. |||:||.||:||
 Worm     1 MENIKASTEQLCAEANIQRKKVSEVSKELLDFCEKNKTNDMLVSGPTDQH-NPFQEKKSCSVL 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 18/56 (32%)
gpc-1NP_001379097.1 GGL 1..62 CDD:128520 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I8340
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I4137
Isobase 1 0.950 - 0 Normalized mean entropy S3174
OMA 1 1.010 - - QHG46185
OrthoDB 1 1.010 - - D1581168at2759
OrthoFinder 1 1.000 - - FOG0000162
OrthoInspector 1 1.000 - - otm14742
orthoMCL 1 0.900 - - OOG6_105730
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4581
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.