DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Gng3

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_034446.1 Gene:Gng3 / 14704 MGIID:102704 Length:75 Species:Mus musculus


Alignment Length:65 Identity:27/65 - (41%)
Similarity:40/65 - (61%) Gaps:2/65 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKS-SCTVL 70
            |:.|.|.:||||:.||::.|..:|::.|.:|.|...|..||.|:|...:.: ||||||. .|.:|
Mouse    12 SIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSE-NPFREKKFFCALL 75

  Fly    71  70
            Mouse    76  75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 23/56 (41%)
Gng3NP_034446.1 GGL 13..75 CDD:128520 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11276
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5429
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000162
OrthoInspector 1 1.000 - - mtm8721
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.