powered by:
Protein Alignment Ggamma1 and Gng3
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_034446.1 |
Gene: | Gng3 / 14704 |
MGIID: | 102704 |
Length: | 75 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 27/65 - (41%) |
Similarity: | 40/65 - (61%) |
Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 SLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKS-SCTVL 70
|:.|.|.:||||:.||::.|..:|::.|.:|.|...|..||.|:|...:.: ||||||. .|.:|
Mouse 12 SIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSE-NPFREKKFFCALL 75
Fly 71 70
Mouse 76 75
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
23/56 (41%) |
Gng3 | NP_034446.1 |
GGL |
13..75 |
CDD:128520 |
25/62 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I11276 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
56 |
1.000 |
Inparanoid score |
I5429 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000162 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm8721 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13809 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 7.060 |
|
Return to query results.
Submit another query.