DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Gng2

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_034445.1 Gene:Gng2 / 14702 MGIID:102705 Length:71 Species:Mus musculus


Alignment Length:51 Identity:10/51 - (19%)
Similarity:22/51 - (43%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 RYNQQKMANPGPREDLEAVADNYEMNIVTVLYLITIITKLLRKEQFVRTEE 486
            ::.:.|:.:..||..:....:|.:...:...|:..|:.|  .|.|....:|
Mouse    14 QWEKVKLVSTKPRSQVPVYIENEQSRSIIYDYIRGILNK--TKTQLTFNDE 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024
Gng2NP_034445.1 GGL 9..71 CDD:128520 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.