DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Klp54D

DIOPT Version :10

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:XP_061516746.1 Gene:Klp54D / 1280785 VectorBaseID:AGAMI1_004503 Length:868 Species:Anopheles gambiae


Alignment Length:34 Identity:8/34 - (23%)
Similarity:18/34 - (52%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VVEQLRREAAIDRQTISESCAKMMKYITEHEQED 47
            :.|.|::|  :|::.|.:|...:...:|.:...|
Mosquito   725 IPELLQKE--LDKRRIGDSITTIANNLTRNNSWD 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 8/34 (24%)
Klp54DXP_061516746.1 None

Return to query results.
Submit another query.