DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and CG43324

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_001246399.1 Gene:CG43324 / 12798331 FlyBaseID:FBgn0263029 Length:66 Species:Drosophila melanogaster


Alignment Length:67 Identity:41/67 - (61%)
Similarity:55/67 - (82%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCT 68
            |:::|||||.:..|||||..::|..:|.:|:.||||:.|||:||.||:||| ||||||||||||:
  Fly     1 MAANLQQQRSINLQLRREVEMERMPVSVACSLMMKYMLEHEEEDCLLSGFT-QKVNPFREKSSCS 64

  Fly    69 VL 70
            :|
  Fly    65 IL 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 35/56 (63%)
CG43324NP_001246399.1 GGL 5..61 CDD:238024 35/56 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 0.240 Domainoid score I11186
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5442
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1581168at2759
OrthoFinder 1 1.000 - - FOG0000162
OrthoInspector 1 1.000 - - mtm6366
orthoMCL 1 0.900 - - OOG6_105730
Panther 1 1.100 - - P PTHR13809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.