DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and gng3

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_571916.1 Gene:gng3 / 114462 ZFINID:ZDB-GENE-010705-1 Length:75 Species:Danio rerio


Alignment Length:65 Identity:27/65 - (41%)
Similarity:39/65 - (60%) Gaps:2/65 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKS-SCTVL 70
            |:.|.|.:||||:.||:..|..:|::.|.:|.|...|..||.|:|...:.: ||||||. .|.:|
Zfish    12 SVGQARKLVEQLKIEASFCRIKVSKAAADLMAYCDAHACEDPLITPVPTSE-NPFREKKFFCALL 75

  Fly    71  70
            Zfish    76  75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 23/56 (41%)
gng3NP_571916.1 GGL 13..75 CDD:128520 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 0.240 Domainoid score I11186
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5442
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1581168at2759
OrthoFinder 1 1.000 - - FOG0000162
OrthoInspector 1 1.000 - - mtm6366
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.