DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and Gng12

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_446113.1 Gene:Gng12 / 114120 RGDID:621516 Length:72 Species:Rattus norvegicus


Alignment Length:66 Identity:27/66 - (40%)
Similarity:43/66 - (65%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
            ::|..|.|..|:|||.||:|:|..:|::.|.:|.|..||.:.|.||.|..:.: |||::|.:|.:
  Rat     8 TNSTAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSE-NPFKDKKTCII 71

  Fly    70 L 70
            |
  Rat    72 L 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 23/56 (41%)
Gng12NP_446113.1 GGL 12..72 CDD:128520 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341944
Domainoid 1 1.000 53 1.000 Domainoid score I11035
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5343
OMA 1 1.010 - - QHG46185
OrthoDB 1 1.010 - - D1581168at2759
OrthoFinder 1 1.000 - - FOG0000162
OrthoInspector 1 1.000 - - mtm12318
orthoMCL 1 0.900 - - OOG6_105730
Panther 1 1.100 - - O PTHR13809
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.