DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma1 and GNG14

DIOPT Version :9

Sequence 1:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_001303621.1 Gene:GNG14 / 105372280 HGNCID:53439 Length:107 Species:Homo sapiens


Alignment Length:102 Identity:24/102 - (23%)
Similarity:36/102 - (35%) Gaps:36/102 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MSSSLQQQRVVVEQLRREAAIDRQTISES-------------------------------CAKM- 36
            ::|.:.|....||||:.||.||:..:...                               |.|| 
Human     7 INSDIGQALWAVEQLQMEAGIDQVKVRVGASAGGGKRWEHMGQGTGACLGLVWLNQLVCRCPKMA 71

  Fly    37 ---MKYITEHEQEDYLLTGFTSQKVNPFREKSSCTVL 70
               :|:.||..:.|..|.|..: ..|.|:||....:|
Human    72 ADLLKFCTEQAKNDPFLVGIPA-ATNSFKEKKPYAIL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 21/91 (23%)
GNG14NP_001303621.1 GGL 18..103 CDD:294053 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11335
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5434
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1581168at2759
OrthoFinder 1 1.000 - - FOG0000162
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13809
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.