powered by:
Protein Alignment Ggamma1 and gng10
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001191941.1 |
Gene: | gng10 / 100485891 |
XenbaseID: | XB-GENE-5804909 |
Length: | 68 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 25/66 - (37%) |
Similarity: | 42/66 - (63%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 SSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
:|:....:.||||||.||:::|..:|::.|::.:|..::..:|.||.|..:.. |||||..||.:
Frog 4 NSNFSTMQRVVEQLRLEASVERIKVSQAAAELQQYCMQNACKDALLVGMPAGS-NPFREPRSCAL 67
Fly 70 L 70
|
Frog 68 L 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
21/56 (38%) |
gng10 | NP_001191941.1 |
GGL |
10..63 |
CDD:238024 |
21/53 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I10936 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
57 |
1.000 |
Inparanoid score |
I5241 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1581168at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000162 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm9382 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13809 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 8.070 |
|
Return to query results.
Submit another query.