powered by:
Protein Alignment Ggamma1 and gngt2.1
DIOPT Version :9
Sequence 1: | NP_523662.1 |
Gene: | Ggamma1 / 35881 |
FlyBaseID: | FBgn0004921 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001165092.1 |
Gene: | gngt2.1 / 100329130 |
XenbaseID: | XB-GENE-5831105 |
Length: | 69 |
Species: | Xenopus tropicalis |
Alignment Length: | 58 |
Identity: | 23/58 - (39%) |
Similarity: | 34/58 - (58%) |
Gaps: | 1/58 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 RVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTV 69
::.|||||:|...:|..:|:|..::..||..|..||.|:.|....| |||:||..|.:
Frog 12 KMEVEQLRKEVKTERIMVSKSIPEIKSYIESHISEDPLVKGVPEDK-NPFKEKGGCLI 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma1 | NP_523662.1 |
GGL |
8..65 |
CDD:238024 |
21/52 (40%) |
gngt2.1 | NP_001165092.1 |
GGL |
8..69 |
CDD:128520 |
23/58 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I10936 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13809 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.