DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MrgBP and EAF7

DIOPT Version :9

Sequence 1:NP_610417.1 Gene:MrgBP / 35880 FlyBaseID:FBgn0033341 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_014263.1 Gene:EAF7 / 855586 SGDID:S000005080 Length:425 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:57/248 - (22%)
Similarity:93/248 - (37%) Gaps:80/248 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WSAEEELQLFHAMEGLRPVGINKHFYMSCIVQRLSK--------------SLNREMPSELIWRHL 75
            |:..:|::|.......:|.||:|||:|.|||:|::.              .|.:...::.||..|
Yeast     5 WTIVDEIRLLRWASEFKPAGIHKHFHMFCIVERMNSPDKYPVTLLQKETMKLGKVFTAKDIWDKL 69

  Fly    76 GTMYKLKELDDLE---SLPFPNE-----------------------------EREFSLPEQDYGT 108
            ...|.|:::|::|   ||....|                             :::|:||.::||.
Yeast    70 SQSYNLEKIDEMENTYSLEATTESSRNGNGNGDDAEIHEETLLELNNRIRVRKQDFTLPWEEYGE 134

  Fly   109 L---QTKKTVEVHANEEAAEAQSAPPTAETNGKAPPATKTPVPTNSTKDGDKKPVAKPQEQLP-- 168
            |   ..:|:  .::|||....:.......|..|..|:|..   .|.....:|....|.:| ||  
Yeast   135 LILENARKS--PNSNEEYPRVEDMNEKDSTIPKESPSTDL---KNDNNKQEKNATIKVKE-LPEY 193

  Fly   169 ------------KRPAKRT--------RGSMSNES---ISPSTTPPPVQSNKR 198
                        |.|.|..        |..||.|.   .|.:.|..||:.::|
Yeast   194 HTEENDSPIDVQKEPIKEVQSDEKELQREHMSEEEQKMKSTNKTAAPVRKSQR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MrgBPNP_610417.1 Eaf7 29..106 CDD:285187 27/122 (22%)
EAF7NP_014263.1 Eaf7 9..132 CDD:400315 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I3193
eggNOG 1 0.900 - - E1_KOG4051
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005866
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105343
Panther 1 1.100 - - LDO PTHR13581
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5107
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.