DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MrgBP and AT1G26470

DIOPT Version :9

Sequence 1:NP_610417.1 Gene:MrgBP / 35880 FlyBaseID:FBgn0033341 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_564248.1 Gene:AT1G26470 / 839188 AraportID:AT1G26470 Length:133 Species:Arabidopsis thaliana


Alignment Length:105 Identity:33/105 - (31%)
Similarity:56/105 - (53%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLAVAGTAAPLP---AALDHEWS-AEEELQLFHAMEGLRPV---GINKHFYMSCIVQRLSKSLNR 64
            ||:|......||   ::|..|.| .|.||:|..|:|...||   ||::||.:..:::.|.:|.:|
plant    21 GLSVHSPCKALPSSASSLSKEQSQVELELRLLEALEIYPPVKLRGIHRHFVLYGLMEYLGRSFDR 85

  Fly    65 EMPSELIWRHLGTMYKLKEL-DDLESLPFPNEEREFSLPE 103
            ...::.:.:.|...|.::.| .|.|.:...|.|.:|:||:
plant    86 PFTADEVLQLLDRFYNIEMLKSDDEDIDILNHEEDFTLPQ 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MrgBPNP_610417.1 Eaf7 29..106 CDD:285187 24/79 (30%)
AT1G26470NP_564248.1 Eaf7 65..128 CDD:400315 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105343
Panther 1 1.100 - - LDO PTHR13581
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.