DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MrgBP and Mrgbp

DIOPT Version :9

Sequence 1:NP_610417.1 Gene:MrgBP / 35880 FlyBaseID:FBgn0033341 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_082755.1 Gene:Mrgbp / 73247 MGIID:1920497 Length:204 Species:Mus musculus


Alignment Length:204 Identity:73/204 - (35%)
Similarity:108/204 - (52%) Gaps:22/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKGLAVAGTAAPLPAALDHEWSAEEELQLFHAMEGLRPVGINKHFYMSCIVQRLSKSLNREMPSE 69
            |||   .|.|||.||.....||.|.|:.|||||.|.:|||:|:||:|.||..:.|:::.|::||:
Mouse    14 DKG---PGEAAPSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSK 75

  Fly    70 LIWRHLGTMYKLKELDDLESLPFPNEEREFSLPEQDYGTLQTKKTV-EVHANEEAAE-------A 126
            :||.||.|||.::.|.:.|.|||||.||.|.||::....::..|.| |....||..|       |
Mouse    76 VIWDHLSTMYDMQALHESEILPFPNPERNFVLPDEIIQEVREGKVVIEEEMKEEMKEDVDPHSGA 140

  Fly   127 QSAPPTAETNGKAPPATKTPVPTNSTKDGDKKPVAKPQEQLPKRPAKRTRGSMSNESISPSTTPP 191
            .....::.:.|||...:......||:..|.|:..           .||.|..::::.::.::.|.
Mouse   141 DDVFSSSGSLGKALEKSSKDKEKNSSDLGCKEGA-----------DKRKRSRVTDKVLTANSNPS 194

  Fly   192 PVQSNKRRR 200
            ...:.||||
Mouse   195 SPSAAKRRR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MrgBPNP_610417.1 Eaf7 29..106 CDD:285187 39/76 (51%)
MrgbpNP_082755.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 9/15 (60%)
Eaf7 36..>94 CDD:400315 28/57 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..204 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846154
Domainoid 1 1.000 71 1.000 Domainoid score I9437
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10104
Inparanoid 1 1.050 114 1.000 Inparanoid score I4827
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005866
OrthoInspector 1 1.000 - - oto95076
orthoMCL 1 0.900 - - OOG6_105343
Panther 1 1.100 - - LDO PTHR13581
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.