DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MrgBP and mrgbp

DIOPT Version :9

Sequence 1:NP_610417.1 Gene:MrgBP / 35880 FlyBaseID:FBgn0033341 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001025681.1 Gene:mrgbp / 595073 XenbaseID:XB-GENE-948003 Length:200 Species:Xenopus tropicalis


Alignment Length:201 Identity:67/201 - (33%)
Similarity:105/201 - (52%) Gaps:33/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLPAALDHE---WSAEEELQLFHAMEGLRPVGINKHFYMSCIVQRLSKSLNREMPSELIWRHLGT 77
            |.||....|   ||.|.|:.|||||.|.:|||:|:||:|.||..:.|:::.|::.|.:||.||.:
 Frog    16 PPPAPPAEEPVLWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVSSRVIWEHLRS 80

  Fly    78 MYKLKELDDLESLPFPNEEREFSLPE-------------QDYGTLQTKKTVEVHANEEAAEAQSA 129
            ||.::.|.:.|.|||||.|:.|.|||             ::....:.|:.||:|...:.|...|.
 Frog    81 MYDMQALHESEILPFPNSEKNFILPEDLIQEVKEGKVTSEEELKEEVKEEVEIHGGSDEAFVNSG 145

  Fly   130 PPTAETNGKAPPATKTPVPTNSTKDGDKKPVAKPQEQLPKRPAKRTRGSMSNESISPSTTPPPVQ 194
             .:.:...|||...:|...::|.:.|||:              ||:|  ::.:..:.::.|....
 Frog   146 -NSGKGLDKAPGKERTLSESSSKESGDKR--------------KRSR--LTEKVQNANSNPSSPN 193

  Fly   195 SNKRRR 200
            :|||||
 Frog   194 ANKRRR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MrgBPNP_610417.1 Eaf7 29..106 CDD:285187 37/89 (42%)
mrgbpNP_001025681.1 Eaf7 36..>91 CDD:311728 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5107
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.