DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MrgBP and MRGBP

DIOPT Version :9

Sequence 1:NP_610417.1 Gene:MrgBP / 35880 FlyBaseID:FBgn0033341 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_060740.1 Gene:MRGBP / 55257 HGNCID:15866 Length:204 Species:Homo sapiens


Alignment Length:206 Identity:73/206 - (35%)
Similarity:108/206 - (52%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKDKGLAVAGTAAPLPAALDHEWSAEEELQLFHAMEGLRPVGINKHFYMSCIVQRLSKSLNREMP 67
            |.|||   .|.||..||.....||.|.|:.|||||.|.:|||:|:||:|.||..:.|:::.|::|
Human    12 AGDKG---PGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVP 73

  Fly    68 SELIWRHLGTMYKLKELDDLESLPFPNEEREFSLPEQDYGTLQTKKT-VEVHANEEAAE------ 125
            |::||.||.|||.::.|.:.|.|||||.||.|.|||:....::..|. :|....||..|      
Human    74 SKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHN 138

  Fly   126 -AQSAPPTAETNGKAPPATKTPVPTNSTKDGDKKPVAKPQEQLPKRPAKRTRGSMSNESISPSTT 189
             |.....::.:.|||...:......||:..|.|:..           .||.|..::::.::.::.
Human   139 GADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGA-----------DKRKRSRVTDKVLTANSN 192

  Fly   190 PPPVQSNKRRR 200
            |....:.||||
Human   193 PSSPSAAKRRR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MrgBPNP_610417.1 Eaf7 29..106 CDD:285187 40/76 (53%)
MRGBPNP_060740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 9/17 (53%)
Eaf7 36..112 CDD:400315 40/75 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..204 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155712
Domainoid 1 1.000 71 1.000 Domainoid score I9502
eggNOG 1 0.900 - - E1_KOG4051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10104
Inparanoid 1 1.050 113 1.000 Inparanoid score I4854
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1476852at2759
OrthoFinder 1 1.000 - - FOG0005866
OrthoInspector 1 1.000 - - oto91492
orthoMCL 1 0.900 - - OOG6_105343
Panther 1 1.100 - - LDO PTHR13581
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5107
SonicParanoid 1 1.000 - - X5633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.