DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MrgBP and mrgbp

DIOPT Version :9

Sequence 1:NP_610417.1 Gene:MrgBP / 35880 FlyBaseID:FBgn0033341 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_957030.1 Gene:mrgbp / 393709 ZFINID:ZDB-GENE-040426-1698 Length:205 Species:Danio rerio


Alignment Length:192 Identity:64/192 - (33%)
Similarity:98/192 - (51%) Gaps:30/192 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WSAEEELQLFHAMEGLRPVGINKHFYMSCIVQRLSKSLNREMPSELIWRHLGTMYKLKELDDLES 89
            ||.|.|:.|||||.|.:|||:|:||:|.||..:.|:::.|::.|::||.||.|||.::.|.:.|.
Zfish    27 WSQEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVSSKVIWDHLSTMYDMQALHESEI 91

  Fly    90 LPFPNEEREFSLPEQDYGTLQTKKTVEVHANEEAAE---AQSAPPTAETNGKAPPATKTPVPTNS 151
            |||||.|:.|.|||:   .:|..|..:|.:.::..|   .:|.||.....|.          .:|
Zfish    92 LPFPNSEKSFVLPEE---IIQDVKEGKVGSEDDVKEEFKEESDPPATHEEGS----------NSS 143

  Fly   152 TKDGDKKPVAKPQEQLPKRPA-------------KRTRGSMSNESISPSTTPPPVQSNKRRR 200
            .|..::....:.:|:..|..:             ||.| |.:.|.:..|:.|......||||
Zfish   144 VKTSERSSSGREKERAEKGASGESGSGMKESTGEKRKR-SRAVEKVMNSSNPSSPGGAKRRR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MrgBPNP_610417.1 Eaf7 29..106 CDD:285187 38/76 (50%)
mrgbpNP_957030.1 Eaf7 35..>90 CDD:285187 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590883
Domainoid 1 1.000 68 1.000 Domainoid score I9757
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10104
Inparanoid 1 1.050 102 1.000 Inparanoid score I4971
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1476852at2759
OrthoFinder 1 1.000 - - FOG0005866
OrthoInspector 1 1.000 - - oto39339
orthoMCL 1 0.900 - - OOG6_105343
Panther 1 1.100 - - LDO PTHR13581
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5107
SonicParanoid 1 1.000 - - X5633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.