DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and AMN1

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_009716.1 Gene:AMN1 / 852455 SGDID:S000000362 Length:549 Species:Saccharomyces cerevisiae


Alignment Length:409 Identity:79/409 - (19%)
Similarity:131/409 - (32%) Gaps:151/409 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 NGATDEAIQSVIGQLRWL--RELSLEHCSGLTDAALTGI---NISKLEMSRKQSGSQVSSMDNFY 469
            |.||:.|         |.  |.:|....|.:|...:..|   ..|:|::.:..:.....|...|.
Yeast   113 NTATENA---------WATSRVVSASSLSIVTPTEIKNILVDEFSELKLGQPLTAQHQRSHAVFE 168

  Fly   470 PP--------------YSNTLAERDSLAGSLQSIKISLRSKAEDEIVRDARRKQAMLAAYEMNLI 520
            .|              .:|...||..|..:.||.:.||....::|     |.|:|..||.:   :
Yeast   169 IPEIVENIIKMIVSLESANIPKERPCLRRNPQSYEHSLLMYKDEE-----RAKKAWSAAQQ---L 225

  Fly   521 REDDFEGH-------------------NIQQLRGLRSLNLRGCNKISDV---------------S 551
            |:....||                   |:.:....:||:.:..:...:.               .
Yeast   226 RDPPLVGHKEKKQGALFSCMMVNRLWLNVTRPFLFKSLHFKSVHNFKEFLRTSQETTQVMRPSHF 290

  Fly   552 LKYGLKHI---ELRRLMLSNCQQISLLGMEAMASSCPSI-------------EELDLSDCYNITD 600
            :.:.|..:   ::.||....||.:..|....    ||.|             |:|.:....||.|
Yeast   291 ILHKLHQVTQPDIERLSRMECQNLKWLEFYV----CPRITPPLSWFDNLHKLEKLIIPGNKNIDD 351

  Fly   601 KTIQVVTSKLPRLKALHISGCSQLTEHTLDAIITNCSCLQTLSIYRCR-------------SMYT 652
            ..:..::..:|.||.|.:..|..:::..:..|..||..|:|.:|.|.|             ..||
Yeast   352 NFLLRLSQSIPNLKHLVLRACDNVSDSGVVCIALNCPKLKTFNIGRHRRGNLITSVSLVALGKYT 416

  Fly   653 DLE-------------------------ERLS----------------GVKTLRNL------NMD 670
            .:|                         ||||                .:.:..||      |:|
Yeast   417 QVETVGFAGCDVDDAGIWEFARLNGKNVERLSLNSCRLLTDYSLPILFALNSFPNLAVLEIRNLD 481

  Fly   671 NLTSIDNAEFFRL-KKRLD 688
            .:|.:.:...:.| ||.||
Yeast   482 KITDVRHFVKYNLWKKSLD 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 8/31 (26%)
leucine-rich repeat 270..295 CDD:275381
leucine-rich repeat 296..319 CDD:275381
leucine-rich repeat 322..346 CDD:275381
leucine-rich repeat 347..399 CDD:275381
leucine-rich repeat 400..426 CDD:275381 4/15 (27%)
leucine-rich repeat 427..535 CDD:275381 28/145 (19%)
AMN1 515..>642 CDD:187754 29/176 (16%)
leucine-rich repeat 536..560 CDD:275381 3/41 (7%)
leucine-rich repeat 561..586 CDD:275381 6/24 (25%)
leucine-rich repeat 587..612 CDD:275381 6/37 (16%)
leucine-rich repeat 613..638 CDD:275381 7/24 (29%)
leucine-rich repeat 639..663 CDD:275381 12/77 (16%)
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381
leucine-rich repeat 167..192 CDD:275381
leucine-rich repeat 193..244 CDD:275381
C2 <231..274 CDD:301316
leucine-rich repeat 246..269 CDD:275381
AMN1NP_009716.1 AMN1 285..509 CDD:187754 44/220 (20%)
leucine-rich repeat 314..337 CDD:275381 4/26 (15%)
leucine-rich repeat 338..363 CDD:275381 5/24 (21%)
leucine-rich repeat 364..389 CDD:275381 7/24 (29%)
leucine-rich repeat 390..417 CDD:275381 6/26 (23%)
leucine-rich repeat 418..443 CDD:275381 1/24 (4%)
leucine-rich repeat 444..471 CDD:275381 4/26 (15%)
leucine-rich repeat 472..493 CDD:275381 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.