DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and FBXL17

DIOPT Version :10

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_005272105.1 Gene:FBXL17 / 64839 HGNCID:13615 Length:712 Species:Homo sapiens


Alignment Length:399 Identity:90/399 - (22%)
Similarity:159/399 - (39%) Gaps:90/399 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SLSL-KRCLPLFMSGSFLDSYNNSCPDLNDLASNLAGIKELTLCENQYLTDAILMRLTSFMPSLE 194
            :||| :|||    |.|.:      |....||..:....|:|.|...|.:||.:|.::.|...::.
Human   335 NLSLDERCL----SASLV------CKYWRDLCLDFQFWKQLDLSSRQQVTDELLEKIASRSQN
II 389

  Fly   195 AINMSGCHIAFHNAI-----------HRRFYPATSSSD----------------HVLPSESVLTF 232
            .||:|.|.....|.:           ....|.....||                || .::..||.
Human   390 EINISDCRSMSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHV-GNQDKLTD 453

  Fly   233 KFILTILNLQRRTLRVLNFS--HTLIGQALLALCDLNLQLQRLYLAGCRQLNCTTILNFLATQPQ 295
            :. |..|..:.|.|:.::|.  :.:..:.::.:....|:|||:|                     
Human   454 EG-LKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIY--------------------- 496

  Fly   296 LCALDLSATMCVNDENLAALVQTNPQLEHLKVNGCLSITNAGAIHLAKLKCLKSLDISNCDNLTS 360
                 :.....|.|:::.|..:..|:|:::...|| |:|:.|.|||.||:.|.|||:.:...|.:
Human   497 -----MQENKLVTDQSVKAFAEHCPELQYVGFMGC-SVTSKGVIHLTKLRNLSSLDLRHITELDN 555

  Fly   361 SGIIEGIASEENPVIQEL-NVSYLQIC------EECIKAIASNLRCLRSLHLNHCVNGATDEAIQ 418
            ..::|        :::.. |:|.|.:|      :.|::.||...:.|:.|:|..|  ..||.|:.
Human   556 ETVME--------IVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSC--KITDYALI 610

  Fly   419 SVIGQLRWLRELSLEHCSGLTDAALTGINISKLEMSRKQSGSQVSSMDNFYPPYSNTLAERDSLA 483
            ::......:..:.:..|..:||...|  .|::...|.:..|  :...|.....|........|:.
Human   611 AIGRYSMTIETVDVGWCKEITDQGAT--LIAQSSKSLRYLG--LMRCDKVRVDYQVVCFLHISIV 671

  Fly   484 GSLQSIKIS 492
            .||.|..:|
Human   672 NSLMSYPLS 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 F-box_SF 11..58 CDD:459239
leucine-rich repeat 129..166 CDD:275381 11/35 (31%)
leucine-rich repeat 167..192 CDD:275381 8/24 (33%)
leucine-rich repeat 193..244 CDD:275381 14/77 (18%)
C2 <231..274 CDD:472691 10/44 (23%)
leucine-rich repeat 246..269 CDD:275381 2/24 (8%)
AMN1 269..440 CDD:187754 40/177 (23%)
leucine-rich repeat 270..295 CDD:275381 4/24 (17%)
leucine-rich repeat 296..319 CDD:275381 3/22 (14%)
leucine-rich repeat 322..346 CDD:275381 11/23 (48%)
leucine-rich repeat 347..399 CDD:275381 13/58 (22%)
leucine-rich repeat 400..426 CDD:275381 7/25 (28%)
leucine-rich repeat 427..535 CDD:275381 14/66 (21%)
AMN1 515..>642 CDD:187754
leucine-rich repeat 536..560 CDD:275381
leucine-rich repeat 561..586 CDD:275381
leucine-rich repeat 587..612 CDD:275381
leucine-rich repeat 613..638 CDD:275381
leucine-rich repeat 639..663 CDD:275381
FBXL17XP_005272105.1 F-box_FBXO13 320..368 CDD:438864 13/42 (31%)
leucine-rich repeat 362..387 CDD:275381 8/24 (33%)
leucine-rich repeat 388..413 CDD:275381 5/24 (21%)
AMN1 411..573 CDD:187754 41/198 (21%)
leucine-rich repeat 414..439 CDD:275381 3/24 (13%)
leucine-rich repeat 440..465 CDD:275381 6/26 (23%)
leucine-rich repeat 466..491 CDD:275381 2/24 (8%)
leucine-rich repeat 492..517 CDD:275381 7/50 (14%)
leucine-rich repeat 518..541 CDD:275381 11/23 (48%)
leucine-rich repeat 542..567 CDD:275381 6/32 (19%)
leucine-rich repeat 568..593 CDD:275381 6/24 (25%)
leucine-rich repeat 594..615 CDD:275381 7/22 (32%)
leucine-rich repeat 619..641 CDD:275381 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.