DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and Fbxo39

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_006533964.2 Gene:Fbxo39 / 628100 MGIID:3505735 Length:480 Species:Mus musculus


Alignment Length:586 Identity:107/586 - (18%)
Similarity:192/586 - (32%) Gaps:214/586 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LPLEIVLKIFSYLGYSDLQAAGSTCQRWHAALDQAEFNQRTRVCF----SKVVLSDQLSPGVDLM 74
            ||...:.::|.:||..|...|...|::|:..:..|:..:...:.|    |:|..|:         
Mouse    56 LPDVCLRRVFWWLGDRDRSRAALVCRKWNQIMYSADLWRYRTITFSGRPSRVHASE--------- 111

  Fly    75 RCERRFQHFLFEDVTLGQVKELMRFMGRTAQSLALDNVDLNDKQFYGMLGVLPHLHSLSLKRCLP 139
                      ||. .|..:|:..|:         |:::::.....|.  .||.....::::..| 
Mouse   112 ----------FES-ALWYIKKFGRY---------LEHLEIKFLNPYN--AVLTKKFQVTMRGLL- 153

  Fly   140 LFMSGSFLDSYNNSCPDLNDLASNLAGIKELTLCE---NQYLTDAILMRLTSFMPS----LEAIN 197
                 |.|...||....|:        |:.|.|..   ...:..:::..|:.|:..    |:.::
Mouse   154 -----SCLGKSNNRLRSLS--------IQHLELDRLVWRNSIRGSLIKSLSFFLKKMGKHLDHLS 205

  Fly   198 MSGCHIAFHNAIHRRFYPATSSSDHVLPSESVLTFKFILTILNLQRRTLRVLNFSHTLIGQALLA 262
            :.|..:......            |:|.|.|.:..:.:.:.||::.      .|||         
Mouse   206 LKGARLTVEQGC------------HILNSLSYMQNENMASELNIED------FFSH--------- 243

  Fly   263 LCDLNLQLQRLYLAGCRQLNCTTILNFLATQPQLCALDLSATMCVNDENLAALVQTNPQLEHLKV 327
                     .|.:.|..|.|     ..:||...|..|.|:.. |::||    |::|         
Mouse   244 ---------HLAVYGSSQFN-----KAMATFRNLTFLTLNYN-CISDE----LLET--------- 280

  Fly   328 NGCLSITNAGAIHLAKLKCLKSLDISNCDNLTSSGIIEGIASEENPVIQELNVSYLQICEECIKA 392
               ||..|||.:....:||                   .:......|:  ..:|:.::..:    
Mouse   281 ---LSENNAGTLRTMNIKC-------------------HVHDPHGQVV--WGMSWAKLARQ---- 317

  Fly   393 IASNLRCLRSLHLNHCVNGATD-----EAIQSVIGQLRWLRELSLEHCSGLTDAALTGINISKLE 452
             ||||:          ||...:     |.:..::.|...:|.:||..|           ..|..:
Mouse   318 -ASNLK----------VNFFFERVMKYERLARILLQEIPVRSISLRSC-----------YFSDPD 360

  Fly   453 MSRKQSGSQVSSMDNFYPPYSNTLAE--------RDSLAGSLQSIKISLRS------------KA 497
            .|.:      .::.:..|.:.|||.:        .:||...|..:.::.|.            |.
Mouse   361 WSMR------PTLTDLLPTFRNTLQKLTFEFNNNHESLDEQLHLLILACRKLFYFKIWAFLDVKF 419

  Fly   498 EDEIVRDARRKQAMLAA---------YEMNLIREDDFEGHNIQQLRGLRSLNLRGCNKISDVSLK 553
            .:.|::.....|..|..         ||.|   |:|         |.||.: .|...|:.|..|.
Mouse   420 VERILKSQEEGQCSLHTLKVRIYTNRYETN---EED---------RTLREI-YRKYRKLIDSELN 471

  Fly   554 Y 554
            |
Mouse   472 Y 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 35/175 (20%)
leucine-rich repeat 270..295 CDD:275381 6/24 (25%)
leucine-rich repeat 296..319 CDD:275381 7/22 (32%)
leucine-rich repeat 322..346 CDD:275381 5/23 (22%)
leucine-rich repeat 347..399 CDD:275381 6/51 (12%)
leucine-rich repeat 400..426 CDD:275381 4/30 (13%)
leucine-rich repeat 427..535 CDD:275381 23/136 (17%)
AMN1 515..>642 CDD:187754 13/40 (33%)
leucine-rich repeat 536..560 CDD:275381 7/19 (37%)
leucine-rich repeat 561..586 CDD:275381
leucine-rich repeat 587..612 CDD:275381
leucine-rich repeat 613..638 CDD:275381
leucine-rich repeat 639..663 CDD:275381
F-box-like 12..>44 CDD:289689 9/29 (31%)
leucine-rich repeat 129..166 CDD:275381 6/36 (17%)
leucine-rich repeat 167..192 CDD:275381 5/27 (19%)
leucine-rich repeat 193..244 CDD:275381 8/50 (16%)
C2 <231..274 CDD:301316 5/42 (12%)
leucine-rich repeat 246..269 CDD:275381 3/22 (14%)
Fbxo39XP_006533964.2 F-box-like 53..94 CDD:372399 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.