DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and FipoQ

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:684 Identity:128/684 - (18%)
Similarity:232/684 - (33%) Gaps:247/684 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDLPLEIVLKIFSYLGYSDLQAAGSTCQRWHAALDQAEFNQRTRVCFSKVVLSDQLSPGVDLMRC 76
            :.||.:::|.|||||.:.::......|:||.    |..::.|   .:..|.|..::|        
  Fly    35 EKLPDKVLLHIFSYLSHREICRLARICRRWR----QIAYDTR---LWKNVSLRPEVS-------- 84

  Fly    77 ERRFQHFLFEDVTLGQVKELMRFM----GRTAQSLALDNVDLNDKQFYGMLGVLPH--LHSLSLK 135
                      .:.:|.::.|::.:    |.|.:.:.|.            :.::.|  ||.||.|
  Fly    85 ----------GLHVGSLEMLLQLISVRFGPTLRYIELP------------IELITHTVLHELSAK 127

  Fly   136 RCLPLFMSGSFLDSYNNSCPDLNDLASNLAGIKELTLCENQYLTDAILMRLTSFMPSLEAINMSG 200
                              ||:|..:                         |..|..:::      
  Fly   128 ------------------CPNLTHM-------------------------LLDFSTAMQ------ 143

  Fly   201 CHIAFHNAIHRRFYPATSSSDHVLPSESVLTFKFILTILNLQRRTLRVLNFSHTLIGQALLALCD 265
                .|:....:.:|.......|..||.:....|:..|.|.    :..|...| |||  ....|:
  Fly   144 ----LHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNF----INGLEVLH-LIG--TYEKCE 197

  Fly   266 LNLQLQRLY-LAGCRQLNCTTILNFLATQPQLCALDLSATMCVNDENLAALVQTNPQLEHLKVNG 329
              .:.:.:| :....:|...|        |.|..::|.....::|.::.|......|||.|.||.
  Fly   198 --EEEEEIYEVINVHKLKSAT--------PNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNF 252

  Fly   330 CLSITNAGAIHL----AKLKCLKSLDISNCDNLTSSGIIEGIASEENPVIQELNVSYLQICEECI 390
            |..:|.:....|    .:|.||    :.|..:|.|..:::  |..:...:|||:::...:..||:
  Fly   253 CNKVTGSTLKTLIQRSKRLTCL----LMNGTSLKSEFVMQ--AEWDKCALQELDITATDLSTECL 311

  Fly   391 KAIASNLRCLRSLHLNHCVNGATDEAIQSVIGQLRWLRELSLEHCSGLTDAALTGINISKLEMSR 455
            ..:.|.:..|:.|.... :||..|..::      :|:.       ||.|                
  Fly   312 VDMLSRIPSLKFLSAGQ-INGFNDSVLK------QWME-------SGTT---------------- 346

  Fly   456 KQSGSQVSSMDNFYPPYSNTLAERDSLAGSLQSIKISLRSKAEDEIVRDARRKQAMLAAYEMNLI 520
                                        .||.|:.:.......||                 .|:
  Fly   347 ----------------------------RSLISLDLDSSDNISDE-----------------GLL 366

  Fly   521 REDDFEGHNIQQLRGLRSLNLRGCNKISDVSLKYGLKHIELRRL-MLSNCQQISL-----LG--- 576
            :....:||.      |.:..|.|...|:|        .:.:..| :|.||:.|.:     ||   
  Fly   367 KFIQRQGHQ------LSACCLSGMPHITD--------QLWMSILPLLGNCKIIVMGTAEKLGVNI 417

  Fly   577 -----MEAMASSCPSIEELDL---SDCYNITDKTIQVVTSKLPRLKALHISGCSQLTE----HTL 629
                 |:.:||:|.::|.|:|   .|....:||:.:.:  .:.|:|.|.:. |..|::    .|:
  Fly   418 HVDQLMDTIASNCGNLERLELRWDPDNLRFSDKSQKAI--DILRVKCLKLR-CMVLSDGRYYETV 479

  Fly   630 DA---------IITNCSCLQTLSIYRCRSMYTDL 654
            .|         ::...:|.: :|.|.....|.||
  Fly   480 KANFERADRITVVRTTTCCR-VSPYHLLRNYNDL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 38/175 (22%)
leucine-rich repeat 270..295 CDD:275381 3/25 (12%)
leucine-rich repeat 296..319 CDD:275381 4/22 (18%)
leucine-rich repeat 322..346 CDD:275381 9/27 (33%)
leucine-rich repeat 347..399 CDD:275381 11/51 (22%)
leucine-rich repeat 400..426 CDD:275381 5/25 (20%)
leucine-rich repeat 427..535 CDD:275381 11/107 (10%)
AMN1 515..>642 CDD:187754 33/156 (21%)
leucine-rich repeat 536..560 CDD:275381 5/23 (22%)
leucine-rich repeat 561..586 CDD:275381 11/38 (29%)
leucine-rich repeat 587..612 CDD:275381 6/27 (22%)
leucine-rich repeat 613..638 CDD:275381 6/37 (16%)
leucine-rich repeat 639..663 CDD:275381 5/16 (31%)
F-box-like 12..>44 CDD:289689 11/31 (35%)
leucine-rich repeat 129..166 CDD:275381 8/36 (22%)
leucine-rich repeat 167..192 CDD:275381 2/24 (8%)
leucine-rich repeat 193..244 CDD:275381 8/50 (16%)
C2 <231..274 CDD:301316 9/42 (21%)
leucine-rich repeat 246..269 CDD:275381 6/22 (27%)
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/51 (27%)
leucine-rich repeat 131..156 CDD:275381 5/59 (8%)
leucine-rich repeat 157..175 CDD:275381 4/17 (24%)
leucine-rich repeat 219..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..270 CDD:275381 8/24 (33%)
leucine-rich repeat 271..295 CDD:275381 7/29 (24%)
leucine-rich repeat 296..320 CDD:275381 6/23 (26%)
leucine-rich repeat 321..348 CDD:275381 9/84 (11%)
leucine-rich repeat 349..375 CDD:275381 6/42 (14%)
leucine-rich repeat 376..403 CDD:275381 8/34 (24%)
leucine-rich repeat 405..432 CDD:275381 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.