DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and Fbxl7

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster


Alignment Length:464 Identity:111/464 - (23%)
Similarity:188/464 - (40%) Gaps:142/464 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LTDAILMRLTSFMPSLEAINMSGCHIAFHNAIHRRFYPATSSSDHVLPSESVLTFKFIL-TILNL 241
            |.|..::|:.|::.|.|.     |::|   .:.|||       :|       |.::.|| .:::|
  Fly   404 LPDEAVVRIFSWLDSCEL-----CNVA---RVCRRF-------EH-------LAWRPILWKVISL 446

  Fly   242 Q------RRTLRVLNFSHTLIGQALLALCDLNLQLQRLYLA-GCRQLNCTTILNFLATQPQLCAL 299
            :      .:||:::  ...|.||:....|.   :::|:.|| |||                    
  Fly   447 RGEHLNGDKTLKMI--FRQLCGQSCNGACP---EVERVMLADGCR-------------------- 486

  Fly   300 DLSATMCVNDENLAALVQTNPQLEHLKVNGCLSITNAGAIH-LAKLKCLKSLDISNCDNLTSSGI 363
                   ::|:.|..|.:..|:|.||::..|:.|||...:. |.|...|:.||::.|..::|   
  Fly   487 -------ISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSS--- 541

  Fly   364 IEGIASEENPVIQ---ELNVSYLQICEEC-------IKAIASNLRCLRSLHLNHCVNGATDEAIQ 418
                 ...||.::   .|.:.||.: .:|       :|.:..|...|..|:|..|:. .||..::
  Fly   542 -----ISPNPHMEPPRRLLLQYLDL-TDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQ-VTDAGLK 599

  Fly   419 SVIGQLRWLRELSLEHCSGLTDAALTGINISKLEMSRKQSGSQVSSMDNFYPPYSNTLAERDSLA 483
            .|......|:|||:..|..:||..|       .|:::                          |.
  Fly   600 FVPSFCVSLKELSVSDCLNITDFGL-------YELAK--------------------------LG 631

  Fly   484 GSLQSIKISLRSKAEDEIVRDARRKQAMLAAYEMNLIREDDFEGHNIQQLRGLRSLNLRGCNKIS 548
            .:|:.:.:     |:.|.|.||..|......|:                   ||.||.|||..:|
  Fly   632 AALRYLSV-----AKCERVSDAGLKVIARRCYK-------------------LRYLNARGCEAVS 672

  Fly   549 DVSLKYGLKHI-ELRRLMLSNCQQISLLGMEAMASSCPSIEELDLSDCYNITDKTIQVVTSKLPR 612
            |.|:....:.. .||.|.:..| .:|..|:.|:|.|||::::|.|..|..|||:.:|.:......
  Fly   673 DDSITVLARSCPRLRALDIGKC-DVSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCRG 736

  Fly   613 LKALHISGC 621
            |:.|:|..|
  Fly   737 LQQLNIQDC 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 44/182 (24%)
leucine-rich repeat 270..295 CDD:275381 6/25 (24%)
leucine-rich repeat 296..319 CDD:275381 3/22 (14%)
leucine-rich repeat 322..346 CDD:275381 9/24 (38%)
leucine-rich repeat 347..399 CDD:275381 13/61 (21%)
leucine-rich repeat 400..426 CDD:275381 7/25 (28%)
leucine-rich repeat 427..535 CDD:275381 18/107 (17%)
AMN1 515..>642 CDD:187754 33/108 (31%)
leucine-rich repeat 536..560 CDD:275381 10/24 (42%)
leucine-rich repeat 561..586 CDD:275381 10/24 (42%)
leucine-rich repeat 587..612 CDD:275381 7/24 (29%)
leucine-rich repeat 613..638 CDD:275381 4/9 (44%)
leucine-rich repeat 639..663 CDD:275381
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381
leucine-rich repeat 167..192 CDD:275381 4/13 (31%)
leucine-rich repeat 193..244 CDD:275381 11/57 (19%)
C2 <231..274 CDD:301316 10/49 (20%)
leucine-rich repeat 246..269 CDD:275381 5/22 (23%)
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 15/64 (23%)
leucine-rich repeat 441..460 CDD:275381 3/18 (17%)
AMN1 <451..595 CDD:187754 42/185 (23%)
leucine-rich repeat 476..501 CDD:275381 9/51 (18%)
leucine-rich repeat 502..521 CDD:275381 7/18 (39%)
leucine-rich repeat 528..555 CDD:275381 7/34 (21%)
leucine-rich repeat 556..581 CDD:275381 5/25 (20%)
AMN1 577..746 CDD:187754 58/228 (25%)
leucine-rich repeat 582..607 CDD:275381 7/25 (28%)
leucine-rich repeat 608..633 CDD:275381 10/57 (18%)
leucine-rich repeat 634..659 CDD:275381 7/29 (24%)
leucine-rich repeat 660..685 CDD:275381 10/24 (42%)
leucine-rich repeat 686..710 CDD:275381 10/24 (42%)
leucine-rich repeat 711..735 CDD:275381 7/23 (30%)
leucine-rich repeat 737..761 CDD:275381 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457922
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.