DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and fbxl15

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_998107.1 Gene:fbxl15 / 405878 ZFINID:ZDB-GENE-040426-2440 Length:296 Species:Danio rerio


Alignment Length:278 Identity:67/278 - (24%)
Similarity:112/278 - (40%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ICEECIKAIASNLRCLRSLHLNHCVNGATDEAIQSVIGQLRWLRELSLEHCSGLTDAALTGINIS 449
            |..|...:|..:.:.|:.|.:.:|.:..||..:..||||.:.|:.:.|..|:.|:..||..:::|
Zfish    71 IPREAFCSILRHNQVLQHLSVTNCSDWITDTDLLPVIGQNQQLQHVDLRGCAQLSRRALVAVSLS 135

  Fly   450 KLEMSRKQSGSQVSSMDNFYPPYSNTLAE---RDSLAGSLQSIKISLRSKAEDEIVRDARRKQAM 511
               ..|.|..|               ||.   .||||         |||.|:             
Zfish   136 ---CPRLQHLS---------------LAHCEWVDSLA---------LRSLAD------------- 160

  Fly   512 LAAYEMNLIREDDFEGHNIQQLRGLRSLNLRGCNKISDVSLKY-GLKHIELRRLMLSNCQQISLL 575
                                ....||||:|..|.::.|.::.| ..|..|||.|.::....|:..
Zfish   161 --------------------HCPMLRSLDLTACRQLKDPAVCYLAGKCPELRALSVAVNANITDT 205

  Fly   576 GMEAMASSCPSIEELDLSDCYNITDKTIQVVTSKLPRLKALHISGCSQLTEHTLDAIITNCSCLQ 640
            .:|.:|..|..:|.|||:.|..:.::.|:.:....|:|::|.::.|..:||             .
Zfish   206 AVEEVAKKCREMERLDLTGCLRVRNEAIRTLAEYCPKLQSLKVNHCHNVTE-------------S 257

  Fly   641 TLSIYRCRSMYTDLEERL 658
            :|.:.|.|::..|:|..|
Zfish   258 SLGVLRRRNVEIDVEPPL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 16/54 (30%)
leucine-rich repeat 270..295 CDD:275381
leucine-rich repeat 296..319 CDD:275381
leucine-rich repeat 322..346 CDD:275381
leucine-rich repeat 347..399 CDD:275381 3/13 (23%)
leucine-rich repeat 400..426 CDD:275381 9/25 (36%)
leucine-rich repeat 427..535 CDD:275381 20/110 (18%)
AMN1 515..>642 CDD:187754 29/127 (23%)
leucine-rich repeat 536..560 CDD:275381 9/24 (38%)
leucine-rich repeat 561..586 CDD:275381 7/24 (29%)
leucine-rich repeat 587..612 CDD:275381 6/24 (25%)
leucine-rich repeat 613..638 CDD:275381 5/24 (21%)
leucine-rich repeat 639..663 CDD:275381 6/20 (30%)
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381
leucine-rich repeat 167..192 CDD:275381
leucine-rich repeat 193..244 CDD:275381
C2 <231..274 CDD:301316
leucine-rich repeat 246..269 CDD:275381
fbxl15NP_998107.1 F-box 16..>52 CDD:279040
leucine-rich repeat 51..85 CDD:275381 3/13 (23%)
leucine-rich repeat 86..112 CDD:275381 9/25 (36%)
AMN1 <111..272 CDD:187754 53/233 (23%)
leucine-rich repeat 113..138 CDD:275381 7/27 (26%)
LRR 1 138..159 12/44 (27%)
leucine-rich repeat 139..164 CDD:275381 12/81 (15%)
LRR 2 164..185 8/20 (40%)
leucine-rich repeat 165..190 CDD:275381 9/24 (38%)
LRR 3 190..211 6/20 (30%)
leucine-rich repeat 191..216 CDD:275381 7/24 (29%)
LRR 4 216..237 6/20 (30%)
leucine-rich repeat 217..242 CDD:275381 6/24 (25%)
LRR 5 242..263 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.