DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and CG32085

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster


Alignment Length:563 Identity:114/563 - (20%)
Similarity:188/563 - (33%) Gaps:227/563 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PHLH----SLSLKRCLPLFMSGSFLDSYNNSCPDLNDLASNLAGIKELTLCEN------QYLTD- 180
            ||||    |:.:....||.|      .:....|.::       .|::|.|.:.      ||.:. 
  Fly   249 PHLHHPYGSMGINAASPLIM------QHQLHPPPIH-------SIEQLMLDDRFLSRFFQYFSPY 300

  Fly   181 --AILMRL---------------TSFMPSL---EAINMSGCHIA-FHNAIHRRFYPA---TSSSD 221
              .||.::               :..:|:|   |...|.||... .:|::.||.:.|   ..:||
  Fly   301 ERRILAQVCIKWRDTLYRSPRYWSGLLPTLQCRELRQMPGCDRGKLYNSLIRRGFHALGLVGASD 365

  Fly   222 HVLPSESVL--TFKFILTILNLQRRTLRVLNFSHTLIGQALLALCDLNLQLQRLYLAGCRQLN-- 282
                 |..|  ...|.|...::...:||..:.|    .:.|..|.|....|..|.||||.::.  
  Fly   366 -----EDALDVVHSFPLASKHVHSLSLRCSSIS----DRGLETLLDHLQSLFELELAGCNEVTEA 421

  Fly   283 ----CTTILNFLATQPQLCALDLSATMCVNDENLAALVQTNPQL--------------------- 322
                |.|        |::.:|.|:..:.:.||.:.|:.|..|.|                     
  Fly   422 GLWACLT--------PRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPK 478

  Fly   323 -EH----LKVNGCLSITNAGAIHLA-KLKCLKSLDISNCDNLTSSGIIEGIASEENPVIQELNVS 381
             .|    |::..|..:||.|.:::. .|..|..|.:|.|..||..|                   
  Fly   479 QSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDG------------------- 524

  Fly   382 YLQICEECIKAIASNLRCLRSLHLNHCVNGATDEAIQSVIGQLRWLRELSLEHCSGLTDAALTGI 446
                    ::.||.||:.||:|.|:.|.. .||.:::.:...|..|.||:|:.|..:||..:   
  Fly   525 --------VELIAENLQKLRALDLSWCPR-ITDASLEYIACDLNQLEELTLDRCVHITDIGV--- 577

  Fly   447 NISKLEMSRKQSGSQVSSMDNFYPPYSNTLAERDSLAGSLQSIKISLRSKAEDEIVRDARRKQAM 511
                                                                             
  Fly   578 ----------------------------------------------------------------- 577

  Fly   512 LAAYEMNLIREDDFEGHNIQQLRGLRSLNLRGCNKISDVSLKYGLKHIELRRLMLSNCQQISLLG 576
                           |: |..:..|.:|.||.|:::.|    :||:|:    ..:.|.|.:||.|
  Fly   578 ---------------GY-ISTMLSLTALFLRWCSQVRD----FGLQHL----CSMRNLQVLSLAG 618

  Fly   577 MEAMASSCPS-------IEELDLSDCYNITDKTIQVVTSKLPR 612
            ...:.||..|       ::||:|::|...:.:....:...|||
  Fly   619 CPLLTSSGLSSLIQLRHLQELELTNCPGASHELFDYLKEHLPR 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 48/203 (24%)
leucine-rich repeat 270..295 CDD:275381 8/30 (27%)
leucine-rich repeat 296..319 CDD:275381 6/22 (27%)
leucine-rich repeat 322..346 CDD:275381 8/50 (16%)
leucine-rich repeat 347..399 CDD:275381 11/51 (22%)
leucine-rich repeat 400..426 CDD:275381 8/25 (32%)
leucine-rich repeat 427..535 CDD:275381 9/107 (8%)
AMN1 515..>642 CDD:187754 26/105 (25%)
leucine-rich repeat 536..560 CDD:275381 9/23 (39%)
leucine-rich repeat 561..586 CDD:275381 7/24 (29%)
leucine-rich repeat 587..612 CDD:275381 5/24 (21%)
leucine-rich repeat 613..638 CDD:275381 114/563 (20%)
leucine-rich repeat 639..663 CDD:275381
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381 7/40 (18%)
leucine-rich repeat 167..192 CDD:275381 7/48 (15%)
leucine-rich repeat 193..244 CDD:275381 15/59 (25%)
C2 <231..274 CDD:301316 9/42 (21%)
leucine-rich repeat 246..269 CDD:275381 6/22 (27%)
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 6/27 (22%)
AMN1 383..600 CDD:187754 64/344 (19%)
leucine-rich repeat 431..456 CDD:275381 6/24 (25%)
leucine-rich repeat 457..482 CDD:275381 1/24 (4%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 11/51 (22%)
leucine-rich repeat 535..560 CDD:275381 8/25 (32%)
leucine-rich repeat 561..585 CDD:275381 9/107 (8%)
leucine-rich repeat 586..610 CDD:275381 9/31 (29%)
leucine-rich repeat 636..661 CDD:275381 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457963
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.