DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and Fbxl22

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001102239.1 Gene:Fbxl22 / 363083 RGDID:1311830 Length:236 Species:Rattus norvegicus


Alignment Length:179 Identity:46/179 - (25%)
Similarity:85/179 - (47%) Gaps:24/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 ERDSLAGSLQSIKISLRSKAEDEIVRDARRKQAMLAAYEMNLIREDDFEGHNIQQLRGLRSLNLR 542
            ::|| ..||......||...||..:      .::|..:.:..:::|:|     :....||||:: 
  Rat    19 DKDS-RKSLSRTCSQLRDVFEDPTL------WSLLHFHSLTELKKDNF-----RLSPALRSLSI- 70

  Fly   543 GC---NKISDVSLKYGLKHIELRRLMLSNCQQISLLGME---AMASSCPSIEELDLSDCYNITDK 601
             |   :::...|::..||....|    |.|.|...|..:   .:.:.||::..:.||.|.::||.
  Rat    71 -CWHSSRVQVCSIEDWLKSAFQR----SICSQHENLVNDFLLQVCNRCPNLASVTLSGCGHVTDD 130

  Fly   602 TIQVVTSKLPRLKALHISGCSQLTEHTLDAIITNCSCLQTLSIYRCRSM 650
            .:..:....|||:||.:..|:::|..||.|:..:...|||..:..||::
  Rat   131 CLARLLLGCPRLRALRLENCARVTNRTLAAVAAHGRALQTFHVDFCRNV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754
leucine-rich repeat 270..295 CDD:275381
leucine-rich repeat 296..319 CDD:275381
leucine-rich repeat 322..346 CDD:275381
leucine-rich repeat 347..399 CDD:275381
leucine-rich repeat 400..426 CDD:275381
leucine-rich repeat 427..535 CDD:275381 11/56 (20%)
AMN1 515..>642 CDD:187754 34/132 (26%)
leucine-rich repeat 536..560 CDD:275381 8/26 (31%)
leucine-rich repeat 561..586 CDD:275381 6/27 (22%)
leucine-rich repeat 587..612 CDD:275381 5/24 (21%)
leucine-rich repeat 613..638 CDD:275381 8/24 (33%)
leucine-rich repeat 639..663 CDD:275381 5/12 (42%)
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381
leucine-rich repeat 167..192 CDD:275381
leucine-rich repeat 193..244 CDD:275381
C2 <231..274 CDD:301316
leucine-rich repeat 246..269 CDD:275381
Fbxl22NP_001102239.1 F-box-like 3..43 CDD:403981 8/30 (27%)
AMN1 44..>191 CDD:187754 38/147 (26%)
leucine-rich repeat 116..141 CDD:275381 5/24 (21%)
leucine-rich repeat 142..167 CDD:275381 8/24 (33%)
leucine-rich repeat 168..193 CDD:275381 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346597
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.