DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and Dmac2

DIOPT Version :10

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_017444840.1 Gene:Dmac2 / 361520 RGDID:1549698 Length:278 Species:Rattus norvegicus


Alignment Length:132 Identity:32/132 - (24%)
Similarity:63/132 - (47%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 IREDDFEGHNIQQLR--GLRSLNLRGCNKISDVSLKY-GLKHI----ELRRLMLSNCQQISLLGM 577
            ||.:| .||:|.:|:  .:.:::..||      ::.| ||.::    ||:.|.|..|..:....:
  Rat   130 IRPND-RGHSIAELQKVPVEAVDASGC------AINYQGLSNLLPLKELQFLSLQRCPNLDDWCL 187

  Fly   578 EAMASSCPSIEELDLSDCYNITDKTIQVVTSKLPRLKALHISGCSQ-----LTEHTLDAIITNCS 637
            ..:.....|::||.|:.|..|:::.:..: ..|..|:.|.||....     ||:..::.::.:|.
  Rat   188 SRLYLLAGSLQELSLAGCPRISERGLACL-HHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCE 251

  Fly   638 CL 639
            .|
  Rat   252 VL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 F-box_SF 11..58 CDD:459239
leucine-rich repeat 129..166 CDD:275381
leucine-rich repeat 167..192 CDD:275381
leucine-rich repeat 193..244 CDD:275381
C2 <231..274 CDD:472691
leucine-rich repeat 246..269 CDD:275381
AMN1 269..440 CDD:187754
leucine-rich repeat 270..295 CDD:275381
leucine-rich repeat 296..319 CDD:275381
leucine-rich repeat 322..346 CDD:275381
leucine-rich repeat 347..399 CDD:275381
leucine-rich repeat 400..426 CDD:275381
leucine-rich repeat 427..535 CDD:275381 7/16 (44%)
AMN1 515..>642 CDD:187754 32/132 (24%)
leucine-rich repeat 536..560 CDD:275381 5/28 (18%)
leucine-rich repeat 561..586 CDD:275381 4/24 (17%)
leucine-rich repeat 587..612 CDD:275381 6/24 (25%)
leucine-rich repeat 613..638 CDD:275381 7/29 (24%)
leucine-rich repeat 639..663 CDD:275381 1/1 (100%)
Dmac2XP_017444840.1 leucine-rich repeat 147..160 CDD:275381 2/18 (11%)
PPP1R42 <161..>229 CDD:455733 17/68 (25%)
leucine-rich repeat 171..196 CDD:275381 4/24 (17%)
leucine-rich repeat 197..221 CDD:275381 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.