DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and FBXL4

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001265645.1 Gene:FBXL4 / 26235 HGNCID:13601 Length:621 Species:Homo sapiens


Alignment Length:699 Identity:150/699 - (21%)
Similarity:243/699 - (34%) Gaps:209/699 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 YGMLGVLPHLHSLSLKRCLPLFMSGSFLDSY-----NNSCPDLN-----------DLAS------ 162
            :.||.||...:.:.|:|.......|..::::     |:....||           |.:|      
Human     5 FPMLTVLTMFYYICLRRRARTATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVDFSSHYGSEN 69

  Fly   163 -------NLAGIKELTLCENQYLTDAILMRLTSFMPSLEAINMSGCHIAFHNAIHRRFYPATSSS 220
                   ||||:..:......:...|:.....::.....:.::.          .:|..|...|.
Human    70 SMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLP----------FKRTPPNFQSQ 124

  Fly   221 DHVLPSESVLTFKFILTILNLQRRTLRVLNFSHTLIGQALLALCDLN---------LQLQRLYLA 276
            |:|     .|||:     ..:....:.||...|......:|| |..|         ::.:.|:..
Human   125 DYV-----ELTFE-----QQVYPTAVHVLETYHPGAVIRILA-CSANPYSPNPPAEVRWEILWSE 178

  Fly   277 GCRQLNCTTILNFLATQPQLCALDLSATMCVNDENLAALVQTNPQLEHLKVNGCL----SITNAG 337
            ...::|.:....|   :|           |:...|.    .||  |..|:||..|    :..:|.
Human   179 RPTKVNASQARQF---KP-----------CIKQINF----PTN--LIRLEVNSSLLEYYTELDAV 223

  Fly   338 AIHLAKLKCLKSLDISNCD--------------------NLTSSGIIEGIASEENP--------- 373
            .:|..|.|.:.||..|..|                    |...|..:.|    |.|         
Human   224 VLHGVKDKPVLSLKTSLIDMNDIEDDAYAEKDGCGMDSLNKKFSSAVLG----EGPNNGYFDKLP 284

  Fly   374 --VIQELNVSYLQICEECIKAIASNL---RC---LRSLHLN-----HCVNGATDEAIQSVIGQLR 425
              :|| |.:::|.:.:.|..|....|   .|   |:.:|||     ..::..:.|.:||....::
Human   285 YELIQ-LILNHLTLPDLCRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQSRCTLVQ 348

  Fly   426 WLR-----------------------------ELSLEHCSGLTDAALTGINISKLEMSRKQSGSQ 461
            ||.                             |||..|.  |.:..|..|:    ||........
Human   349 WLNLSWTGNRGFISVAGFSRFLKVCGSELVRLELSCSHF--LNETCLEVIS----EMCPNLQALN 407

  Fly   462 VSSMDNFYPPYSNTLAERDSLAGSLQSIK--ISLRSKAEDEIVRDARRKQAMLAAYEMNLIREDD 524
            :||.|...|...|.:|:       |.|:|  :..|:|.|         :.|:|:.  :|...|  
Human   408 LSSCDKLPPQAFNHIAK-------LCSLKRLVLYRTKVE---------QTALLSI--LNFCSE-- 452

  Fly   525 FEGHNIQQLRGLRSLNLRGCNKISD---VSLKYGLKHIELRRLMLSNCQQISLLGMEAMASSCPS 586
                       |:.|:|..|..|.|   ::...|.|..:||.|.|..|:.|:..|:..:||.||.
Human   453 -----------LQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLWRCKNITENGIAELASGCPL 506

  Fly   587 IEELDLSDCYNITDKT--IQVVTSKLPRLKALHISGCSQLTEHTLDAIITNCSCLQTLSIYRCRS 649
            :|||||..|..:...|  ...:..:||.|:.|.::....:.:..:|.:..||:.||.|.|...|.
Human   507 LEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRM 571

  Fly   650 MY-TDLEERLSGVKTLRNLNMDNLTSIDNAEFFRLKKRLDYXYFAAIFI 697
            :. ..|.:.|...|.|..|::...:.|||.....|.     ..|..:||
Human   572 VSPASLRKLLESCKDLSLLDVSFCSQIDNRAVLELN-----ASFPKVFI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 48/245 (20%)
leucine-rich repeat 270..295 CDD:275381 3/24 (13%)
leucine-rich repeat 296..319 CDD:275381 2/22 (9%)
leucine-rich repeat 322..346 CDD:275381 8/27 (30%)
leucine-rich repeat 347..399 CDD:275381 16/85 (19%)
leucine-rich repeat 400..426 CDD:275381 7/30 (23%)
leucine-rich repeat 427..535 CDD:275381 26/138 (19%)
AMN1 515..>642 CDD:187754 37/131 (28%)
leucine-rich repeat 536..560 CDD:275381 8/26 (31%)
leucine-rich repeat 561..586 CDD:275381 10/24 (42%)
leucine-rich repeat 587..612 CDD:275381 8/26 (31%)
leucine-rich repeat 613..638 CDD:275381 5/24 (21%)
leucine-rich repeat 639..663 CDD:275381 7/24 (29%)
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381 10/65 (15%)
leucine-rich repeat 167..192 CDD:275381 1/24 (4%)
leucine-rich repeat 193..244 CDD:275381 8/50 (16%)
C2 <231..274 CDD:301316 9/51 (18%)
leucine-rich repeat 246..269 CDD:275381 7/31 (23%)
FBXL4NP_001265645.1 F-box-like 280..318 CDD:315592 8/38 (21%)
leucine-rich repeat 295..317 CDD:275381 5/21 (24%)
leucine-rich repeat 318..346 CDD:275381 7/27 (26%)
leucine-rich repeat 347..376 CDD:275381 2/28 (7%)
LRR 1 376..397 6/22 (27%)
leucine-rich repeat 377..398 CDD:275381 7/26 (27%)
AMN1 394..601 CDD:332986 64/241 (27%)
LRR 2 402..421 4/18 (22%)
leucine-rich repeat 403..427 CDD:275381 7/30 (23%)
LRR 3 427..448 7/31 (23%)
leucine-rich repeat 428..452 CDD:275381 7/34 (21%)
LRR 4 452..474 7/34 (21%)
leucine-rich repeat 453..480 CDD:275381 8/26 (31%)
LRR 5 480..501 7/20 (35%)
leucine-rich repeat 481..506 CDD:275381 10/24 (42%)
LRR 6 504..524 9/19 (47%)
leucine-rich repeat 507..534 CDD:275381 8/26 (31%)
LRR 7 532..558 5/25 (20%)
leucine-rich repeat 535..560 CDD:275381 5/24 (21%)
LRR 8 559..583 7/23 (30%)
leucine-rich repeat 561..586 CDD:275381 7/24 (29%)
LRR 9 584..609 7/29 (24%)
leucine-rich repeat 587..612 CDD:275381 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.