DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and FBXL7

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_036436.1 Gene:FBXL7 / 23194 HGNCID:13604 Length:491 Species:Homo sapiens


Alignment Length:486 Identity:106/486 - (21%)
Similarity:190/486 - (39%) Gaps:154/486 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LTDAILMRLTSFMPSLEAINMSGCHIAFHNAIHRRFYPATSSSDHVLPSESVL--TFKFILTILN 240
            |.|..::::.||:|:.:.     |..|   .:.||:|.        |..:..|  |.:.....:|
Human   117 LPDHSMVQIFSFLPTNQL-----CRCA---RVCRRWYN--------LAWDPRLWRTIRLTGETIN 165

  Fly   241 LQRRTLRVLNFSHTLIGQALLALC----DLNLQLQRLYLAGCRQLNCTTILNFLATQPQLCALDL 301
            :. |.|:||.          ..||    ::.|.|:.:.::|||:|                    
Human   166 VD-RALKVLT----------RRLCQDTPNVCLMLETVTVSGCRRL-------------------- 199

  Fly   302 SATMCVNDENLAALVQTNPQLEHLKVNGCLSITNAGAIHLAKLKC--LKSLDISNCDNLTSSGII 364
                  .|..|..:.|..|:|..|:|:||.:|:|.....:..| |  |:.||:|.|..:|...:.
Human   200 ------TDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSL-CPNLEHLDVSGCSKVTCISLT 257

  Fly   365 EGIASEENPVI-QELNVSYLQI--C----EECIKAIASNLRCLRSLHLNHCVNGATDEAIQSVIG 422
            ...:.:.:|:. :::::.||.:  |    :|.:..||::...|..|:|..||. .|||.::.::.
Human   258 REASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVR-LTDEGLRYLVI 321

  Fly   423 QLRWLRELSLEHCSGLTDAALTGINISKLEMSRKQSGSQVSSMDNFYPPYSNTLAERDSLAGSLQ 487
            ....::|||:..|..::|..|.  .|:||| ||                                
Human   322 YCASIKELSVSDCRFVSDFGLR--EIAKLE-SR-------------------------------- 351

  Fly   488 SIKISLRSKAEDEIVRDARRKQAMLAAYEMNLIREDDFEGHNIQQLRGLRSLNLRGCNKISDVSL 552
                                                            ||.|::..|.:::||.:
Human   352 ------------------------------------------------LRYLSIAHCGRVTDVGI 368

  Fly   553 KYGLKHI-ELRRLMLSNCQQISLLGMEAMASSCPSIEELDLSDCYNITDKTIQVVTSKLPRLKAL 616
            :|..|:. :||.|....|:.|:..|:|.:|.:|..::.||:..|..::|..::.:......||.|
Human   369 RYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRL 433

  Fly   617 HISGCSQLTEHTLDAIITNCSCLQTLSIYRC 647
            .:..|..:|...|..:..||..||||::..|
Human   434 SLKSCESITGQGLQIVAANCFDLQTLNVQDC 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 43/179 (24%)
leucine-rich repeat 270..295 CDD:275381 5/24 (21%)
leucine-rich repeat 296..319 CDD:275381 3/22 (14%)
leucine-rich repeat 322..346 CDD:275381 8/23 (35%)
leucine-rich repeat 347..399 CDD:275381 13/58 (22%)
leucine-rich repeat 400..426 CDD:275381 8/25 (32%)
leucine-rich repeat 427..535 CDD:275381 12/107 (11%)
AMN1 515..>642 CDD:187754 31/127 (24%)
leucine-rich repeat 536..560 CDD:275381 8/24 (33%)
leucine-rich repeat 561..586 CDD:275381 9/24 (38%)
leucine-rich repeat 587..612 CDD:275381 4/24 (17%)
leucine-rich repeat 613..638 CDD:275381 8/24 (33%)
leucine-rich repeat 639..663 CDD:275381 5/9 (56%)
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381
leucine-rich repeat 167..192 CDD:275381 4/13 (31%)
leucine-rich repeat 193..244 CDD:275381 9/52 (17%)
C2 <231..274 CDD:301316 10/46 (22%)
leucine-rich repeat 246..269 CDD:275381 5/26 (19%)
FBXL7NP_036436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
F-box-like 114..157 CDD:372399 12/55 (22%)
leucine-rich repeat 129..151 CDD:275381 7/37 (19%)
leucine-rich repeat 154..187 CDD:275381 8/43 (19%)
LRR 1 170..195 7/34 (21%)
AMN1 <185..366 CDD:187754 56/291 (19%)
leucine-rich repeat 188..213 CDD:275381 8/50 (16%)
LRR 2 196..221 10/50 (20%)
leucine-rich repeat 214..234 CDD:275381 7/19 (37%)
LRR 3 222..247 8/25 (32%)
leucine-rich repeat 240..273 CDD:275381 7/32 (22%)
LRR 4 253..281 3/27 (11%)
leucine-rich repeat 274..299 CDD:275381 6/24 (25%)
LRR 5 282..307 7/24 (29%)
AMN1 297..464 CDD:187754 53/250 (21%)
leucine-rich repeat 300..325 CDD:275381 8/25 (32%)
LRR 6 308..333 8/25 (32%)
leucine-rich repeat 326..351 CDD:275381 10/27 (37%)
LRR 7 334..359 12/107 (11%)
leucine-rich repeat 352..377 CDD:275381 8/24 (33%)
LRR 8 360..385 8/24 (33%)
leucine-rich repeat 378..403 CDD:275381 9/24 (38%)
LRR 9 386..411 8/24 (33%)
leucine-rich repeat 404..429 CDD:275381 4/24 (17%)
LRR 10 412..437 5/24 (21%)
leucine-rich repeat 430..453 CDD:275381 6/22 (27%)
LRR 11 438..463 9/24 (38%)
leucine-rich repeat 456..480 CDD:275381 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153029
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.