DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and Fbxl21

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001333661.1 Gene:Fbxl21 / 213311 MGIID:2442921 Length:460 Species:Mus musculus


Alignment Length:484 Identity:104/484 - (21%)
Similarity:161/484 - (33%) Gaps:128/484 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LEYGLHRYDDLPLEIVLKIFSYLGYSDLQAAGSTCQRWHAALDQAEFNQRTRVCFSKVVLSDQLS 68
            |::|     .||..::|:||.||...|...|.|.|:||:......                    
Mouse    66 LDWG-----TLPHHVILQIFQYLPLIDRARASSVCRRWNEVFHIP-------------------- 105

  Fly    69 PGVDLMRCERRFQHFLFEDVTLGQVKELMRFMGRTAQSLALDNVDLNDKQFYGMLGVLPHLHSLS 133
               ||.   |:|:..|.:..|        .:...|...|....:..:          ..||..:|
Mouse   106 ---DLW---RKFEFELNQSAT--------SYFKSTHPDLIQQIIKKH----------AAHLQYVS 146

  Fly   134 LKRCLPLFMSGSFLDSYNNSCPDLNDLASNLAGIKELTLCENQYLTDAILMRLTSFMPSLEAINM 198
            .|           :||...|.....|:.|.|..      |..|.| ..|.....|||      |:
Mouse   147 FK-----------VDSSTESAEAACDILSQLVN------CSIQTL-GLISTAKPSFM------NV 187

  Fly   199 SGCHIAFHNAIHRRFYPATSSSDHVLPSESVLTFKFILTILNLQRRTLRVLNFSHT--LIGQALL 261
            ...|  |.:|:...|..:.|.|...:....|......:.:.| ...|||:|..|..  :....:|
Mouse   188 PKSH--FVSALTVVFVNSKSLSSIKIEDTPVDDPSLKILVAN-NSDTLRLLKMSSCPHVSSDGIL 249

  Fly   262 ALCDLNLQLQRLYLAGCRQLNCTTILNFLATQPQLCALDLSATMCVNDENLAAL-VQTNPQLEHL 325
            .:.|        :..|.|:|    .||:               ..::||.|.|| .:|:..||||
Mouse   250 CVAD--------HCQGLREL----ALNY---------------YILSDEILLALSSETHVNLEHL 287

  Fly   326 KVNGCLSITNAGAIHLAKLKCLKSLDI----SNCDNLTSSGII-----EGIASEENPVIQELNVS 381
            :::  :...|.|.|....:| .:|.|.    |...|:.....:     |....||.|      |:
Mouse   288 RID--VVSENPGQIKFHSIK-KRSWDALIKHSPRVNVVMYFFLYEEEFEAFFKEETP------VT 343

  Fly   382 YLQICEECIKAIAS--NLRCLRSLHLNHCVNG--ATDEAIQSVIGQLRWLRELSLEHCSGLTDAA 442
            :|.......:||..  .|.|.|.:.|..|.||  ..|..:..:....:.|..|.|..|.....|.
Mouse   344 HLYFGRSVSRAILGRIGLNCPRLIELVVCANGLLPLDSELIRIAKHCKNLTSLGLSECEVSCSAF 408

  Fly   443 LTGINISKLEMSRKQSGSQVSSMDNFYPP 471
            :..:.:....:::.....:|...|:.|.|
Mouse   409 VEFVRLCGRRLTQLSIMEEVLVPDDRYTP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 43/184 (23%)
leucine-rich repeat 270..295 CDD:275381 5/24 (21%)
leucine-rich repeat 296..319 CDD:275381 5/23 (22%)
leucine-rich repeat 322..346 CDD:275381 7/23 (30%)
leucine-rich repeat 347..399 CDD:275381 13/62 (21%)
leucine-rich repeat 400..426 CDD:275381 6/27 (22%)
leucine-rich repeat 427..535 CDD:275381 9/45 (20%)
AMN1 515..>642 CDD:187754
leucine-rich repeat 536..560 CDD:275381
leucine-rich repeat 561..586 CDD:275381
leucine-rich repeat 587..612 CDD:275381
leucine-rich repeat 613..638 CDD:275381
leucine-rich repeat 639..663 CDD:275381
F-box-like 12..>44 CDD:289689 13/31 (42%)
leucine-rich repeat 129..166 CDD:275381 9/36 (25%)
leucine-rich repeat 167..192 CDD:275381 7/24 (29%)
leucine-rich repeat 193..244 CDD:275381 9/50 (18%)
C2 <231..274 CDD:301316 8/44 (18%)
leucine-rich repeat 246..269 CDD:275381 6/24 (25%)
Fbxl21NP_001333661.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.