DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and FBXO39

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_694962.1 Gene:FBXO39 / 162517 HGNCID:28565 Length:442 Species:Homo sapiens


Alignment Length:588 Identity:102/588 - (17%)
Similarity:189/588 - (32%) Gaps:219/588 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LPLEIVLKIFSYLGYSDLQAAGSTCQRWHAALDQAEFNQRTRVCF----SKVVLSDQLSPGVDLM 74
            ||...:.::|.:||..|...|...|::|:..:..||..:...:.|    |:|..|:..|....:.
Human    19 LPDLCLCRVFWWLGDRDRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVK 83

  Fly    75 RCERRFQHFLFEDVTLGQVKELMRFMGRTAQSLALDNVDLNDKQFYGMLGVLPHLHSLSLKRCLP 139
            :..|..:|.        :||.:..:           |..|..|....|.|:|             
Human    84 KFGRYLEHL--------EVKFMNPY-----------NAVLTKKFQVTMRGLL------------- 116

  Fly   140 LFMSGSFLDSYNNSCPDLNDLASNLAGIKELTLCENQYL-TDAILMR---LTSFMPS-------- 192
                 |.|...||.             :|.|::   ||| .|.::.|   .:||:.|        
Human   117 -----SCLSKSNNR-------------LKSLSI---QYLELDRLVWRNSIRSSFISSLSFFLKKM 160

  Fly   193 ---LEAINMSGCHIAFHNAIHRRFYPATSSSDHVLPSESVLTFKFILTILNLQRRTLRVLNFSHT 254
               |:.:|:.|..:......            .:|.|.|.:..:.:::.||::.      .|||.
Human   161 GKRLDYLNLKGARLTVEQGC------------QILDSLSYMRNENVISELNIED------YFSHH 207

  Fly   255 LIGQALLALCDLNLQLQRLYLAGCRQLNCTTILNFLATQPQLCALDLSATMCVNDENLAALVQTN 319
            |                .:|       |.......::|...|.:|:|:.. |::||.|..|.:  
Human   208 L----------------AVY-------NSPQFKKTMSTFHNLVSLNLNYN-CISDELLENLCE-- 246

  Fly   320 PQLEHLKVNGCLSITNAGAIHLAKLKCLKSLDISNCDNLTSSGIIEGIASEENPVIQELNVSYLQ 384
                           ||..:....:||                   .:......||  ..:|:.:
Human   247 ---------------NASTLRTINIKC-------------------HVHDPHGQVI--WGMSWAK 275

  Fly   385 ICEECIKAIASNLRCLRSLHLNHCVNGATD-----EAIQSVIGQLRWLRELSLEHCSGLTDAALT 444
            :..:     |:||:          ||...:     |.:..::.|...:|.:||..|         
Human   276 LARQ-----ATNLK----------VNFFFERIMKYERLARILLQEIPIRSISLRSC--------- 316

  Fly   445 GINISKLEMSRKQSGSQVSSMDNFYPPYSNTLAE--------RDSLAGSLQSIKISLRS------ 495
              ..|..:.|.:      .::.:..|.:.:||.:        .:||...|..:.||.|.      
Human   317 --YFSDPDCSMR------PTLIDLLPTFRHTLQKLTCEFNNNHESLDEELHLLIISCRKLFYFKI 373

  Fly   496 ------KAEDEIVRDARRKQAMLAAYEMNLIR---EDDFEGHNIQQLRGLRSLNLRGCNKISDVS 551
                  ...:.|::..:.:|..|..::..:..   |.:.|...:|::       .|...|:.:..
Human   374 WAFLDVSFVERILKSQKERQCALRVFKARIYTNRYETNEEDKTLQEI-------YRKYRKLIESE 431

  Fly   552 LKY 554
            |.|
Human   432 LSY 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 29/175 (17%)
leucine-rich repeat 270..295 CDD:275381 3/24 (13%)
leucine-rich repeat 296..319 CDD:275381 8/22 (36%)
leucine-rich repeat 322..346 CDD:275381 2/23 (9%)
leucine-rich repeat 347..399 CDD:275381 6/51 (12%)
leucine-rich repeat 400..426 CDD:275381 4/30 (13%)
leucine-rich repeat 427..535 CDD:275381 21/130 (16%)
AMN1 515..>642 CDD:187754 7/43 (16%)
leucine-rich repeat 536..560 CDD:275381 4/19 (21%)
leucine-rich repeat 561..586 CDD:275381
leucine-rich repeat 587..612 CDD:275381
leucine-rich repeat 613..638 CDD:275381
leucine-rich repeat 639..663 CDD:275381
F-box-like 12..>44 CDD:289689 9/29 (31%)
leucine-rich repeat 129..166 CDD:275381 4/36 (11%)
leucine-rich repeat 167..192 CDD:275381 9/28 (32%)
leucine-rich repeat 193..244 CDD:275381 8/50 (16%)
C2 <231..274 CDD:301316 6/42 (14%)
leucine-rich repeat 246..269 CDD:275381 4/22 (18%)
FBXO39NP_694962.1 F-box-like 16..57 CDD:289689 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.