Sequence 1: | NP_001260812.1 | Gene: | CG8272 / 35875 | FlyBaseID: | FBgn0033337 | Length: | 710 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005272226.1 | Gene: | AK8 / 158067 | HGNCID: | 26526 | Length: | 491 | Species: | Homo sapiens |
Alignment Length: | 186 | Identity: | 40/186 - (21%) |
---|---|---|---|
Similarity: | 65/186 - (34%) | Gaps: | 57/186 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LEYGLHRYDDLPLEIVLKIFSYLGYSDLQAAGSTC-QRWHAALDQAEFNQRTRVCFS-KVVLSDQ 66
Fly 67 LSPGVDLMR-------------CERRFQHFLFEDVTLGQV------KE-------LMRFMGR--- 102
Fly 103 ----TAQSLALDNV--DLNDKQFYGMLGVLPH------------LHSLSLKRCLPL 140 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |