DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8272 and AK8

DIOPT Version :9

Sequence 1:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_005272226.1 Gene:AK8 / 158067 HGNCID:26526 Length:491 Species:Homo sapiens


Alignment Length:186 Identity:40/186 - (21%)
Similarity:65/186 - (34%) Gaps:57/186 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LEYGLHRYDDLPLEIVLKIFSYLGYSDLQAAGSTC-QRWHAALDQAEFNQRTRVCFS-KVVLSDQ 66
            |||  ||      .||..|.||.....:.:|...| ..::.||...:.|.||...|: :|:|...
Human   232 LEY--HR------NIVRVIPSYPKILKVISADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGP 288

  Fly    67 LSPGVDLMR-------------CERRFQHFLFEDVTLGQV------KE-------LMRFMGR--- 102
            :..|..|..             |.:..:..:.:..|.|::      ||       ||:.:.:   
Human   289 VGSGKSLQAALLAQKYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMKVLSQRLD 353

  Fly   103 ----TAQSLALDNV--DLNDKQFYGMLGVLPH------------LHSLSLKRCLPL 140
                ..:...|..|  ||:.......||..|:            :..|:|:|..|:
Human   354 QQDCIQKGWVLHGVPRDLDQAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRRIDPV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8272NP_001260812.1 AMN1 269..440 CDD:187754
leucine-rich repeat 270..295 CDD:275381
leucine-rich repeat 296..319 CDD:275381
leucine-rich repeat 322..346 CDD:275381
leucine-rich repeat 347..399 CDD:275381
leucine-rich repeat 400..426 CDD:275381
leucine-rich repeat 427..535 CDD:275381
AMN1 515..>642 CDD:187754
leucine-rich repeat 536..560 CDD:275381
leucine-rich repeat 561..586 CDD:275381
leucine-rich repeat 587..612 CDD:275381
leucine-rich repeat 613..638 CDD:275381
leucine-rich repeat 639..663 CDD:275381
F-box-like 12..>44 CDD:289689 7/32 (22%)
leucine-rich repeat 129..166 CDD:275381 4/12 (33%)
leucine-rich repeat 167..192 CDD:275381
leucine-rich repeat 193..244 CDD:275381
C2 <231..274 CDD:301316
leucine-rich repeat 246..269 CDD:275381
AK8XP_005272226.1 adk 71..270 CDD:273569 14/45 (31%)
ADK 71..261 CDD:238713 12/36 (33%)
adk 282..480 CDD:273569 22/128 (17%)
ADK 282..474 CDD:238713 22/128 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.